GRB10 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDG |
Predicted Species |
Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GRB10 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for GRB10 Antibody
Background
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ChIP, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC-P
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA
Publications for GRB10 Antibody (NBP1-86387) (0)
There are no publications for GRB10 Antibody (NBP1-86387).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRB10 Antibody (NBP1-86387) (0)
There are no reviews for GRB10 Antibody (NBP1-86387).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GRB10 Antibody (NBP1-86387) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GRB10 Products
Research Areas for GRB10 Antibody (NBP1-86387)
Find related products by research area.
|
Blogs on GRB10