![Western Blot: GPR64 Antibody [NBP2-55504] - Analysis in human cell line A-549 and human cell line A-431.](http://images.novusbio.com/fullsize/GPR64-Antibody-Western-Blot-NBP2-55504-img0010.jpg "Western Blot: GPR64 Antibody [NBP2-55504] - Analysis in human cell line A-549 and human cell line A-431.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NASGVKPQRNICNLSSICNDSAFFRGEIMFQYDKESTVPQNQHITNGTLTGVLSLSELKRSELNKTLQTLSETYFIMCATAEAQSTLNCTFTIKLNNTMNACAVIAALERVKIRPMEHCCCSVRIPCP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADGRG2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GPR64 Antibody (NBP2-55504)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADGRG2 |
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining in human epididymis and endometrium tissues using NBP2-55504 antibody. Corresponding ADGRG2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP2-55504-img0016.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining in human epididymis and endometrium tissues using NBP2-55504 antibody. Corresponding ADGRG2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP2-55504-img0011.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human endometrium, epididymis, liver and skeletal muscle using Anti-ADGRG2 antibody NBP2-55504 (A) shows similar protein distribution across tissues to independent antibody NBP1-84906 (B).](http://images.novusbio.com/fullsize/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP2-55504-img0012.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human endometrium, epididymis, liver and skeletal muscle using Anti-ADGRG2 antibody NBP2-55504 (A) shows similar protein distribution across tissues to independent antibody NBP1-84906 (B).")
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human epididymis shows strong positivity in microvilli in glandular cells.](http://images.novusbio.com/fullsize/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP2-55504-img0013.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human epididymis shows strong positivity in microvilli in glandular cells.")
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP2-55504-img0014.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/GPR64-Antibody-Immunohistochemistry-Paraffin-NBP2-55504-img0015.jpg "Immunohistochemistry-Paraffin: GPR64 Antibody [NBP2-55504] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot GPR56 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR56_AF4634_Western_Blot_11569.jpg)
![Simple Western GPR56 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR56_AF4634_Simple_Western_22172.jpg)
![Flow Cytometry GPR56 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR56_AF4634_Flow_Cytometry_12104.jpg)
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")