GP1BB Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 27-147 of human GP1BB (NP_000398.1). PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GP1BB |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:200-1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for GP1BB Antibody - BSA Free
Background
Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alphachain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor(VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, andGPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling throughphosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated withBernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIbbeta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arisingfrom a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this producthas been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissuessuch as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signalwithin a separate gene (septin 5) located upstream of this gene. In the absence of polyadenylation from its ownimperfect site, the septin 5 gene uses the consensus polyA signal of this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IP (-), WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC
Publications for GP1BB Antibody (NBP3-04913) (0)
There are no publications for GP1BB Antibody (NBP3-04913).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GP1BB Antibody (NBP3-04913) (0)
There are no reviews for GP1BB Antibody (NBP3-04913).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GP1BB Antibody (NBP3-04913) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GP1BB Products
Research Areas for GP1BB Antibody (NBP3-04913)
Find related products by research area.
|
Blogs on GP1BB