![SDS-Page: Recombinant Human Glut2 Protein [H00006514-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00006514-Q01-1.jpg "SDS-Page: Recombinant Human Glut2 Protein [H00006514-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 32-98 of Human Glut2 Source: Wheat Germ (in vitro) Amino Acid Sequence: NAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWS |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | SLC2A2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 33.11 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Glut2 Partial Recombinant Protein (H00006514-Q01)Find related products by research area.
|
|
Deficiency of GluT1 leads to neurological problems while excess is involved in cancers By Jamshed Arslan, Pharm. D., PhD. What Are GluTs?Mammalian cell metabolism is incomplete without glucose . Glucose is a monosaccharide that is transported to the cells through facilitative diffusion, a ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC2A2 |
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX-1_AF2419_Western_Blot_5187.jpg)
![Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Immunocytochemistry_16575.jpg)
![Simple Western PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Simple_Western_16996.jpg)
![Flow Cytometry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Flow_Cytometry_19979.jpg)
![Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Immunocytochemistry__Immunofluorescence_20431.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot IRS2 Antibody (676415) [Unconjugated]](https://images.novusbio.com/images2/IRS2_MAB6347_Western_Blot_11857.jpg)
![Western Blot: Glut2 Antibody [NBP2-22218] - Analysis of Glut2 in total lysates of MIN6 cells using anti-Glut2 (NBP2-22218) antibody at 1/500 dilution. Image was submitted via customer review.](https://images.novusbio.com/images/Glut2-Antibody-Western-Blot-NBP2-22218-img0008.jpg "Western Blot: Glut2 Antibody [NBP2-22218] - Analysis of Glut2 in total lysates of MIN6 cells using anti-Glut2 (NBP2-22218) antibody at 1/500 dilution. Image was submitted via customer review.")