![Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Effect of Diltiazem on L444P and N370S/V394L GC Folding and Trafficking.Western blot analysis of untreated and diltiazem-treated L444P GC cells. L444P GC cells were cultured without or with diltiazem at varying concentrations for 7 d before the cells were lysed for SDS-PAGE and Western blot analysis. GC was detected using mouse anti-GC antibody 2E2. Beta-actin served as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pbio.0060026) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Glucosylceramidase-GBA-Antibody-2E2-Western-Blot-H00002629-M01-img0019.jpg "Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Effect of Diltiazem on L444P and N370S/V394L GC Folding and Trafficking.Western blot analysis of untreated and diltiazem-treated L444P GC cells. L444P GC cells were cultured without or with diltiazem at varying concentrations for 7 d before the cells were lysed for SDS-PAGE and Western blot analysis. GC was detected using mouse anti-GC antibody 2E2. Beta-actin served as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pbio.0060026) licensed under a CC-BY license.")
| Reactivity | Hu, PlSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP |
| Clone | 2E2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | GBA (NP_000148, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS |
| Specificity | GBA - glucosidase, beta; acid (includes glucosylceramidase) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GBA |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recominant protein, transfected lysate and cell lysate for WB. It has been used for IF, IHC-P and ELISA. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Steven Zhou |
WB | ansgenic mice | 10/10/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Glucosylceramidase/GBA Antibody (H00002629-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Glucosylceramidase-GBA-Antibody-2E2-Immunocytochemistry-Immunofluorescence-H00002629-M01-img0012.jpg "Immunocytochemistry/Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Glucosylceramidase-GBA-Antibody-2E2-Immunohistochemistry-Paraffin-H00002629-M01-img0014.jpg "Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.")
![Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - GBA monoclonal antibody (M01), clone 2E2 Analysis of GBA expression in MCF-7.](http://images.novusbio.com/fullsize/Glucosylceramidase-GBA-Antibody-2E2-Western-Blot-H00002629-M01-img0016.jpg "Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - GBA monoclonal antibody (M01), clone 2E2 Analysis of GBA expression in MCF-7.")
![Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of GBA expression in transfected 293T cell line by GBA monoclonal antibody (M01), clone 2E2.Lane 1: GBA transfected lysate(60 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Glucosylceramidase-GBA-Antibody-2E2-Western-Blot-H00002629-M01-img0017.jpg "Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of GBA expression in transfected 293T cell line by GBA monoclonal antibody (M01), clone 2E2.Lane 1: GBA transfected lysate(60 KDa).Lane 2: Non-transfected lysate.")
![ELISA: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Detection limit for recombinant GST tagged GBA is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Glucosylceramidase-GBA-Antibody-2E2-ELISA-H00002629-M01-img0018.jpg "ELISA: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Detection limit for recombinant GST tagged GBA is approximately 1ng/ml as a capture antibody.")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Immunocytochemistry PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Immunocytochemistry_16563.jpg)
![Western Blot PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Western_Blot_16593.jpg)
![Simple Western PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/af8520_human-psap-affinity-purified-polyclonal-ab-simple-western-13420221645.jpg)
