Home » GLP/EHMT1 » GLP/EHMT1 Proteins » GLP/EHMT1 Recombinant Protein Antigen

GLP/EHMT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

GLP/EHMT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLP/EHMT1

Source: E. coli

Amino Acid Sequence: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EHMT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17670.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLP/EHMT1 Recombinant Protein Antigen

  • DEL9q34
  • EC 2.1.1.-
  • EC 2.1.1.43
  • EHMT1
  • euchromatic histone-lysine N-methyltransferase 1H3-K9-HMTase 5
  • Eu-HMTase1
  • Eu-HMTase1DEL9q34
  • EUHMTASE1FP13812
  • FLJ12879
  • G9a-like protein 1
  • GLP
  • GLP1
  • H3 lysine-9 specific 5
  • KIAA1876euchromatic histone methyltransferase 1
  • KMT1D
  • KMT1DDKFZp667M072
  • Lysine N-methyltransferase 1D

Background

Euchromatic histone-lysine N-methyltransferase 1 (EHMT1) is a histone methyltransferase that catalyzes the methylation of lysine-9 of histone H3 (H3-K9). H3-K9 histone methylation is restricted to euchromatin and functions to epigenetically silence gene transcription. Loss of function mutations in EHMT1 cause the 9q34 subtelomeric deletion syndrome, a syndrome characterized by severe mental retardation, hypotonia, brachy(micro)cephaly, heart defects, and distinct facial anomalies. Alternate names for EHMT1 include histone H3-K9 methyltransferase 5, H3-K9-HMTase5, eu-HMTase, G9a-like protein 1, GLP1, lysine N-methyltransferase 1D, EUHMTASE1, KMT1D, and KIAA1876.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
GIP Antibody
(911205) [Unconjugate
MAB8864
Immunohistochemistry GIP Antibody (911205) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
GLP-1R Antibody -
BSA Free
NBP1-97308
Immunocytochemistry/ Immunofluorescence GLP-1R Antibody - BSA Free
Western Blot GLP-1R Antibody - BSA Free
Western Blot GLP-1R Antibody - BSA Free
(29 Publications)
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
DPPIV/CD26
Antibody [Unconjugate
AF1180
Simple Western DPPIV/CD26 Antibody [Unconjugated]
Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]
Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]
(2 Reviews)
(56 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
G9a/EHMT2 Antibody
(A8620A) [Unconjugate ...
PP-A8620A-00
Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
(17 Publications)
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
G protein alpha
Inhibitor 2 Antibody
NBP2-44318
Immunohistochemistry-Paraffin G protein alpha Inhibitor 2 Antibody
Immunohistochemistry-Paraffin G protein alpha Inhibitor 2 Antibody
Western Blot G protein alpha Inhibitor 2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
C1qTNF1/CTRP1
Antibody [Unconjugate
AF3145
C1qTNF1/CTRP1 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: WB
Peptide YY Antibody
NBP1-80865
Immunohistochemistry-Paraffin Peptide YY Antibody
Immunohistochemistry-Paraffin Peptide YY Antibody
Immunohistochemistry-Paraffin Peptide YY Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Somatostatin
Antibody (906552) [Un ...
MAB2358
Immunohistochemistry Somatostatin Antibody (906552) [Unconjugated]
Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]
Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(23 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Cholecystokinin
Antibody
NBP3-18225
Immunocytochemistry/ Immunofluorescence Cholecystokinin Antibody
Immunohistochemistry-Paraffin Cholecystokinin Antibody
Western Blot Cholecystokinin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
VIP Antibody
(OTI1E8)
NBP2-46349
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Species: Hu
Applications: IHC, IHC-P, WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(20 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Ghrelin Antibody
(883622)
MAB8200
Immunohistochemistry Ghrelin Antibody (883622)
Immunohistochemistry Ghrelin Antibody (883622)
(11 Publications)
Species: Hu, Mu
Applications: IHC

Publications for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP) (0)

There are no publications for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP) (0)

There are no reviews for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLP/EHMT1 Products

Research Areas for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP)

Find related products by research area.

Blogs on GLP/EHMT1

There are no specific blogs for GLP/EHMT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of LoVo human colorectal adenocarcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for DPPIV/CD26 at approximately 168 kDa (as indicated) using 2 µg/mL of Goat Anti-Human DPPIV/CD26 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1180) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
DPPIV/CD26 Antibody [Unconjugated]
AF1180
GLP/EHMT1 Antibody (B0422) [Unconjugated]
PP-B0422-00
Immunohistochemistry-Paraffin: Histone H3 Antibody [NB500-171] - Immunoperoxidase staining of Anti-Histone H3 in FFPE mouse testis.
Histone H3 Antibody - BSA Free
NB500-171

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLP/EHMT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EHMT1