Home » GADD153/CHOP » GADD153/CHOP Proteins » GADD153/CHOP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GADD153/CHOP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GADD153/CHOP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GADD153/CHOP.

Source: E. coli

Amino Acid Sequence: AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDIT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49550.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GADD153/CHOP Recombinant Protein Antigen

  • C/EBP-homologous protein 10
  • C/EBP-homologous protein
  • CCAAT/enhancer-binding protein homologous protein
  • CEBP zeta
  • CHOP
  • CHOP10 CEBPZ
  • CHOP10
  • CHOP-10
  • CHOPC/EBP zeta
  • DDIT3
  • DDIT-3
  • DNA damage-inducible transcript 3 protein
  • DNA-damage-inducible transcript 3
  • GADD153
  • Growth arrest and DNA damage-inducible protein GADD153

Background

GADD153 encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(43 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
XBP1 Antibody -
BSA Free
NBP1-77681
Immunohistochemistry XBP1 Antibody - BSA Free
Flow Cytometry XBP1 Antibody - BSA Free
Flow Cytometry XBP1 Antibody - BSA Free
(18 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
ATF6 Antibody
(70B1413.1) - BSA Fre
NBP1-40256
Western Blot ATF6 Antibody (70B1413.1) - BSA Free
Flow (Intracellular) ATF6 Antibody (70B1413.1) - BSA Free
Immunohistochemistry-Paraffin ATF6 Antibody (70B1413.1) - BSA Free
(3 Reviews)
(246 Publications)
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
ATF4 Antibody
NB100-852
Western Blot ATF4 Antibody
Western Blot ATF4 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: PEP-ELISA, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(384 Publications)
Species: Hu, Mu
Applications: ICC, IHC
PERK Antibody
[Unconjugated]
AF3999
Western Blot PERK Antibody [Unconjugated]
Knockout Validated PERK Antibody [Unconjugated]
Western Blot PERK Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: KO, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EBP Antibody
NBP1-85699
Immunocytochemistry/ Immunofluorescence EBP Antibody
Immunohistochemistry-Paraffin EBP Antibody
Immunohistochemistry-Paraffin EBP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SH3D19 Antibody
(5C7)
H00152503-M01
Immunocytochemistry/ Immunofluorescence SH3D19 Antibody (5C7)
Immunohistochemistry-Paraffin SH3D19 Antibody (5C7)
Western Blot SH3D19 Antibody (5C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin FUS Antibody
Immunohistochemistry-Paraffin FUS Antibody
Western Blot FUS Antibody
(4 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TRAILR2/TNFRSF10B
Antibody
NB100-56618
Immunohistochemistry-Paraffin TRAILR2/TNFRSF10B Antibody
Immunohistochemistry TRAILR2/TNFRSF10B Antibody
Western Blot TRAILR2/TNFRSF10B Antibody
(1 Review)
(43 Publications)
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
MID1 Antibody -
BSA Free
NBP3-05061
Immunocytochemistry/ Immunofluorescence MID1 Antibody - BSA Free
Western Blot MID1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
GADD153/CHOP
Recombinant Protein A ...
NBP2-49550PEP
GADD153/CHOP Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP) (0)

There are no publications for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP) (0)

There are no reviews for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GADD153/CHOP Products

Research Areas for GADD153/CHOP Recombinant Protein Antigen (NBP2-49550PEP)

Find related products by research area.

Blogs on GADD153/CHOP

There are no specific blogs for GADD153/CHOP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
GADD153/CHOP Antibody (9C8)
NB600-1335
Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY license.
ATF6 Antibody (70B1413.1) - BSA Free
NBP1-40256-0.1mg

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GADD153/CHOP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DDIT3