![ELISA: Fucosyltransferase 7/FUT7 Antibody (1C12) [H00002529-M03] - Detection limit for recombinant GST tagged FUT7 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Fucosyltransferase-7-FUT7-Antibody-1C12-ELISA-H00002529-M03-img0001.jpg "ELISA: Fucosyltransferase 7/FUT7 Antibody (1C12) [H00002529-M03] - Detection limit for recombinant GST tagged FUT7 is approximately 0.3ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1C12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | FUT7 (NP_004470, 262 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
| Specificity | FUT7 - fucosyltransferase 7 (alpha (1,3) fucosyltransferase), (1C12) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | FUT7 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunohistochemistry_6938.jpg)
![Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunocytochemistry_9821.jpg)
![Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/bba16_human-e-selectin-cd62e-mab-clone-bbig-e4-flow-cytometry-25102021144214.jpg)
![Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]](https://images.novusbio.com/images/antibody/bba24_human-l-selectin-cd62l-mab-cl-4g8-flow-cytometry-822024174319..jpg)
![Immunohistochemistry Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Immunohistochemistry_22592.jpg)
![Immunocytochemistry Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Immunocytochemistry_12684.jpg)
![Western Blot Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GCNT1_AF7248_Western_Blot_12747.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
