Novus Biologicals products are now on bio-techne.com

Recombinant Human FoxP2 GST (N-Term) Protein

Name: Recombinant Human FoxP2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00093986-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human FoxP2 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 616-715 of Human FoxP2 Source: Wheat Germ (in vitro) Amino Acid Sequence: LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	FOXP2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FoxP2 GST (N-Term) Protein

CAG repeat protein 44
CAGH44
CAGH44TNRC10forkhead box protein P2
DKFZp686H1726
forkhead box P2
forkhead/winged-helix transcription factor
FoxP2
SPCH1
TNRC10
trinucleotide repeat containing 10
Trinucleotide repeat-containing gene 10 protein

Background

FOXP2 - forkhead box P2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FoxP1 Antibody
(JC12) - BSA Free

NB100-65125

Immunocytochemistry/ Immunofluorescence FoxP1 Antibody (JC12) - BSA Free

Flow Cytometry FoxP1 Antibody (JC12) - BSA Free

(8 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

FoxP3 Antibody -
BSA Free

NB100-39002

Immunohistochemistry-Paraffin FoxP3 Antibody - BSA Free

(2 Reviews)

(62 Publications)

Species: Bv, Hu, Mu, Rt

Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB

Caspr2 Antibody

NBP1-88182

(1 Review)

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

FoxP4 Antibody

AF6854

Species: Hu

Applications: WB

Prosurfactant
Protein C Antibody

NBP1-87201

Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

IL-2 [Unconjugated]

202-IL

(4 Reviews)

(374 Publications)

Species: Hu

Applications: BA

TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...

NBP2-44501

Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IF, IHC, IHC-P

CFTR Antibody
(24-1) [Unconjugated] ...

MAB25031

Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus

(10 Reviews)

(76 Publications)

Species: Hu

Applications: IHC, IP, WB

SHC2 Antibody

NBP1-87076

Species: Hu

Applications: IHC, IHC-P, WB

ASPM Antibody

NB100-2278

(10 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

DYX1C1 Antibody

NBP1-68766

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, PEP-ELISA, WB

Sonic Hedgehog/Shh
[Unconjugated]

464-SH

SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]

SEC-MALS Sonic Hedgehog/Shh [Unconjugated]

(68 Publications)

Species: Mu

Applications: BA

Pax6 Antibody
[Unconjugated]

AF8150

Immunocytochemistry Pax6 Antibody [Unconjugated]

Western Blot Pax6 Antibody [Unconjugated]

(16 Publications)

Species: Hu

Applications: ICC, ICFlow, Simple Western, WB

Calbindin D-28K
Antibody

NBP2-50028

Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody

(1 Review)

(13 Publications)

Species: Bv, Hu, Mu, Rt

Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB

CD4 Antibody - BSA
Free

NBP1-19371

Immunohistochemistry-Paraffin CD4 Antibody - BSA Free

(9 Reviews)

(50 Publications)

Species: Ca, Hu, Mu, Po, Rb, Rt

Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

KIAA0319 Antibody

NB100-93472

(2 Publications)

Species: Mu

Applications: IHC, IHC-P, PEP-ELISA, WB

Wnt-2 Antibody

AF3464

(1 Publication)

Species: Hu

Applications: IHC, WB

SRPX2 Antibody -
BSA Free

NBP1-77370

Immunohistochemistry-Paraffin SRPX2 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Uteroglobin/SCGB1A1 An ...

MAB4218

(1 Review)

(28 Publications)

Species: Hu

Applications: IHC, WB

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

Publications for FoxP2 Partial Recombinant Protein (H00093986-Q01) (0)

There are no publications for FoxP2 Partial Recombinant Protein (H00093986-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxP2 Partial Recombinant Protein (H00093986-Q01) (0)

There are no reviews for FoxP2 Partial Recombinant Protein (H00093986-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxP2 Partial Recombinant Protein (H00093986-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FoxP2 Products

Blogs on FoxP2

There are no specific blogs for FoxP2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.

IL-2 [Unconjugated]
202-IL-010

CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human FoxP2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

FOXP2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human FoxP2 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human FoxP2 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human FoxP2 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FoxP2 Partial Recombinant Protein (H00093986-Q01) (0)

Reviews for FoxP2 Partial Recombinant Protein (H00093986-Q01) (0)

Product General Protocols

Video Protocols

FAQs for FoxP2 Partial Recombinant Protein (H00093986-Q01) (0)

Additional FoxP2 Products

Blogs on FoxP2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics