FKBP52/FKBP4 Recombinant Protein Antigen

Images

 
There are currently no images for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

FKBP52/FKBP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FKBP52/FKBP4.

Source: E. coli

Amino Acid Sequence: DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FKBP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56131.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FKBP52/FKBP4 Recombinant Protein Antigen

  • 51 kDa FK506-binding protein
  • 52 kDa FKBP
  • 59 kDa immunophilin
  • EC 5.2.1.8
  • FK506 binding protein 4, 59kDa
  • FK506-binding protein 4 (59kD)
  • FK506-binding protein 4
  • FKBP4
  • FKBP-4
  • FKBP51
  • FKBP52
  • FKBP-52
  • FKBP52T-cell FK506-binding protein, 59kD
  • FKBP59
  • FKBP5952 kDa FK506-binding protein
  • HBI
  • HSP binding immunophilin
  • Hsp56
  • HSP-binding immunophilin
  • Immunophilin FKBP52
  • p52
  • p59
  • peptidyl-prolyl cis-trans isomerase FKBP4
  • peptidylprolyl cis-trans isomerase
  • PPIase FKBP4
  • PPIase
  • rotamase

Background

Hsp90 is crucial to cellular signaling by its regulation of the folding, activity, and stability of a wide range of client proteins. These client protein complexes may also contain one or more cochaperones (1). One class of Hsp90-binding cochaperone is composed of proteins with a characteristic tetratricopeptide repeat (TPR) domain that forms an Hsp90 binding site. Among the TPR cochaperones of Hsp90 are Hop/Sti1, protein phosphatase PP5, and members of both the FK506- and cyclosporin Abinding families of immunophilins (2). FK506-binding protein 51 (FKBP51) and FKBP52 are large molecular weight immunophilins that are part of the mature glucocorticoid receptor (GR) heterocomplex (3). The N terminal domain of each protein binds FK506 and has peptidyl-prolyl isomerase (PPIase) activity that converts prolyl peptide bonds within target proteins from cis- to trans- proline. The C-terminal domains contain the TPR repeats involved in protein-protein interactions with the Hsp90 (4). Although FKBP52 and FKBP51 share approx. 75% sequence similarity, they affect hormone binding by glucocorticoid receptor in opposing manners and have different Hsp90- binding characteristics (3, 5). Also, whereas FKBP51 typically has a role with the progesterone receptor, FKBP52 has been found to be linked to the progesterone, androgen and glucocorticoid receptors (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2699
Species: Mu
Applications: Simple Western, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
NBP2-94469
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-85841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-179
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
NBP2-72273
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP3-32238
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP) (0)

There are no publications for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP) (0)

There are no reviews for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FKBP52/FKBP4 Products

Research Areas for FKBP52/FKBP4 Recombinant Protein Antigen (NBP2-56131PEP)

Find related products by research area.

Blogs on FKBP52/FKBP4

There are no specific blogs for FKBP52/FKBP4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FKBP52/FKBP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP4