I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.

Name: FGFR1 Antibody
Brand: Novus Biologicals
SKU: NBP2-33784
Price: 529 USD

Question

Accepted Answer

FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Predicted Species	Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	FGFR1
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP2-33784	Applications	Species
Bin Lee, S;Abdal Dayem, A;Kmiecik, S;Min Lim, K;Sik Seo, D;Kim, HT;Kumar Biswas, P;Do, M;Kim, DH;Cho, SG; wwEfficient improvement of the proliferation, differentiation, and anti-arthritic capacity of mesenchymal stem cells by simply culturing on the immobilized FGF2 derived peptide, 44-ERGVVSIKGV-53 Journal of advanced research 2023-09-28 [PMID: 37777063]
Polash Kumar Biswas, Yeonjoo Kwak, Aram Kim, Jaekwon Seok, Hee Jeong Kwak, Moonjung Lee, Ahmed Abdal Dayem, Kwonwoo Song, Jae-Yong Park, Kyoung Sik Park, Hyun Jin Shin, Ssang-Goo Cho, Giuseppe Lucarelli TTYH3 Modulates Bladder Cancer Proliferation and Metastasis via FGFR1/H-Ras/A-Raf/MEK/ERK Pathway International Journal of Molecular Sciences 2022-09-10 [PMID: 36142409]

FGFR1 Antibody

Species Glossary

Images

Product Details

Order Details

FGFR1 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for FGFR1 Antibody

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FGFR1 Antibody (NBP2-33784)(2)

Reviews for FGFR1 Antibody (NBP2-33784) (0)

Product General Protocols

Video Protocols

FAQs for FGFR1 Antibody (NBP2-33784). (Showing 1 - 2 of 2 FAQs).

Secondary Antibodies

Isotype Controls

Additional FGFR1 Products

Research Areas for FGFR1 Antibody (NBP2-33784)

Blogs on FGFR1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	FGFR1
Uniprot	P11362()