Home » FE65 » FE65 Proteins » FE65 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FE65 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FE65 Recombinant Protein Antigen (NBP2-48682PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FE65 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FE65.

Source: E. coli

Amino Acid Sequence: QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APBB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48682.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FE65 Recombinant Protein Antigen

  • adaptor protein FE65a2
  • amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
  • amyloid beta A4 precursor protein-binding, family B, member 1
  • Fe65
  • FE65amyloid beta A4 precursor protein-binding family B member 1
  • MGC:9072
  • Protein Fe65
  • RIR
  • stat-like protein

Background

Amyloid beta A4 precursor protein-binding family B member 1, also known as FE65, is a signaling adaptor of APP protein. The FE65/APP complex has been shown to translocate into the cell nucleus and regulate gene expression, indicating that FE65 may be critical in the pathogenesis of Alzheimer's disease. Genetic studies in mice validated FE65-APP interaction and molecular studies provided evidence on the role of the complex in abnormal signaling detected in brains of Alzheimer's Disease patients.

FE65 antibodies are useful tools for research on Alzheimer's disease progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
TIP60 Antibody
NBP2-24613
Immunohistochemistry-Paraffin TIP60 Antibody
Western Blot TIP60 Antibody
Simple Western TIP60 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
APBA1 Antibody -
BSA Free
NBP2-41182
Western Blot APBA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence APBA1 Antibody - BSA Free
Western Blot APBA1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
LRP-1 Antibody
(A2Mr alpha-2)
NB100-64808
Immunohistochemistry LRP-1 Antibody (A2Mr alpha-2)
Immunohistochemistry LRP-1 Antibody (A2Mr alpha-2)
Immunohistochemistry LRP-1 Antibody (A2Mr alpha-2)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
APLP-1 Antibody
[Unconjugated]
AF3129
Immunohistochemistry APLP-1 Antibody [Unconjugated]
Simple Western APLP-1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, IP, Simple Western, WB
BACE-1 Antibody
(137612)
MAB931
Western Blot BACE-1 Antibody (137612)
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
Mena Antibody
NBP1-87914
Immunocytochemistry/ Immunofluorescence Mena Antibody
Western Blot Mena Antibody
Immunohistochemistry-Paraffin Mena Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
APLP-2 Antibody
(397702) [Unconjugate
MAB49451
Western Blot APLP-2 Antibody (397702) [Unconjugated]
(2 Publications)
Species: Hu
Applications: WB
APBB2 Antibody
NBP1-84700
Western Blot APBB2 Antibody
Western Blot APBB2 Antibody
Immunohistochemistry-Paraffin APBB2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
SHC1 Antibody
(OTI3A1)
NBP2-02434
Western Blot SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CD82/Kai-1
Antibody (C33) - BSA
NBP2-21792
Flow Cytometry CD82/Kai-1 Antibody (C33) - BSA Free
Immunohistochemistry-Paraffin CD82/Kai-1 Antibody (C33) - BSA Free
Flow Cytometry CD82/Kai-1 Antibody (C33) - BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
APBB3 Antibody
(OTI5G3)
NBP2-01367
Flow Cytometry APBB3 Antibody (OTI5G3)
Western Blot APBB3 Antibody (OTI5G3)
Immunohistochemistry-Paraffin APBB3 Antibody (OTI5G3)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TFCP2 Antibody
H00007024-B01P
Western Blot TFCP2 Antibody
Western Blot TFCP2 Antibody
Western Blot TFCP2 Antibody
Species: Hu, Mu, Rt
Applications: WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MVP Antibody
NBP1-82820
Western Blot MVP Antibody
Immunohistochemistry-Paraffin MVP Antibody
Immunohistochemistry-Paraffin MVP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
RPSA Antibody
(RPSA/2699) - Azide a ...
NBP2-79854
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
PTP alpha/PTPRA
Antibody
NBP3-14454
Immunohistochemistry-Paraffin PTP alpha/PTPRA Antibody
Immunohistochemistry-Paraffin PTP alpha/PTPRA Antibody
Immunohistochemistry-Paraffin PTP alpha/PTPRA Antibody
Species: Hu
Applications: IHC, IHC-P
FE65 Recombinant
Protein Antigen
NBP2-48682PEP
FE65 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FE65 Recombinant Protein Antigen (NBP2-48682PEP) (0)

There are no publications for FE65 Recombinant Protein Antigen (NBP2-48682PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FE65 Recombinant Protein Antigen (NBP2-48682PEP) (0)

There are no reviews for FE65 Recombinant Protein Antigen (NBP2-48682PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FE65 Recombinant Protein Antigen (NBP2-48682PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FE65 Products

Research Areas for FE65 Recombinant Protein Antigen (NBP2-48682PEP)

Find related products by research area.

Blogs on FE65

There are no specific blogs for FE65, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FE65 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol APBB1