Home » Fc epsilon RI beta/MS4A2 » MS4A2 Antibodies » Fc epsilon RI beta/MS4A2 Antibody
Novus Biologicals products are now on bio-techne.com

Fc epsilon RI beta/MS4A2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human small intestine shows strong cytoplasmic positivity in myelopoietic cells.
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human small intestine shows strong cytoplasmic positivity in myelopoietic cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Analysis in human gallbladder and pancreas tissues. Corresponding MS4A2 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human gallbladder shows strong cytoplasmic positivity in myelopoietic cells.
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in myelopoietic cells.
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human skin shows moderate cytoplasmic positivity in myelopoietic cells.
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Fc epsilon RI beta/MS4A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fc epsilon RI beta/MS4A2 Protein (NBP2-31807PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fc epsilon RI beta/MS4A2 Antibody

  • APY
  • ATOPY
  • Fc epsilon receptor I beta-chain
  • Fc epsilon RI beta
  • Fc epsilonRIb
  • FCER1B
  • FCER1BIGEL
  • FCERI
  • High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain)
  • high affinity immunoglobulin epsilon receptor subunit beta
  • IgE Fc receptor subunit beta
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • IGHER
  • immunoglobulin E receptor, high affinity, beta polypeptide
  • Membrane-spanning 4-domains subfamily A member 2
  • membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide)
  • MS4A1
  • MS4A2

Background

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IgE Antibody (1E7)
NBP3-11412
IgE Antibody (1E7)
(5 Publications)
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(149 Publications)
Species: Mu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
IL-4R alpha
[Unconjugated]
230-4RB
IL-4R alpha [Unconjugated]
(1 Publication)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Fc epsilon RI
Antibody (AER-37) - B ...
NBP1-43278
Flow Cytometry Fc epsilon RI Antibody (AER-37) - BSA Free
Immunohistochemistry-Paraffin Fc epsilon RI Antibody (AER-37) - BSA Free
Flow Cytometry Fc epsilon RI Antibody (AER-37) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(217 Publications)
Species: Hu
Applications: BA
Serpin E1/PAI-1
Antibody - BSA Free
NBP1-19773
Western Blot Serpin E1/PAI-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Serpin E1/PAI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin E1/PAI-1 Antibody - BSA Free
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
MS4A3 Antibody
(489433)
MAB6247
Flow Cytometry MS4A3 Antibody (489433)
Species: Hu
Applications: CyTOF-ready, Flow
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
T-bet/TBX21
Antibody (525803) [Un ...
MAB5385
Western Blot T-bet/TBX21 Antibody (525803) [Unconjugated]
Intracellular Staining by Flow Cytometry T-bet/TBX21 Antibody (525803) [Unconjugated]
Intracellular Staining by Flow Cytometry T-bet/TBX21 Antibody (525803) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, ICFlow, WB
LTC4S Antibody
NBP1-69315
Western Blot LTC4S Antibody
Western Blot LTC4S Antibody
Species: Hu
Applications: WB

Publications for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no publications for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no reviews for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fc epsilon RI beta/MS4A2 Products

Research Areas for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Find related products by research area.

Blogs on Fc epsilon RI beta/MS4A2

There are no specific blogs for Fc epsilon RI beta/MS4A2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fc epsilon RI beta/MS4A2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MS4A2
Uniprot