![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0006.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGAT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC27A2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC27A2 |
![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0001.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0002.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Analysis in human kidney and pancreas tissues using Anti-SLC27A2 antibody. Corresponding SLC27A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0003.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Analysis in human kidney and pancreas tissues using Anti-SLC27A2 antibody. Corresponding SLC27A2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Analysis in human kidney and skeletal muscle tissues using NBP3-05516 antibody. Corresponding SLC27A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0004.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Analysis in human kidney and skeletal muscle tissues using NBP3-05516 antibody. Corresponding SLC27A2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0005.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Small intestine shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FATP2-SLC27A2-Antibody-Immunohistochemistry-Paraffin-NBP3-05516-img0007.jpg "Immunohistochemistry-Paraffin: FATP2/SLC27A2 Antibody [NBP3-05516] - Staining of human Small intestine shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunocytochemistry FATP1/SLC27A1 Antibody (308420) [Unconjugated]](https://images.novusbio.com/images2/FATP1_MAB3304_Immunocytochemistry__Immunofluorescence_19621.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")