![Western Blot: FAM62A Antibody [NBP1-84741] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ESYT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/FAM62A-Antibody-Western-Blot-NBP1-84741-img0019.jpg "Western Blot: FAM62A Antibody [NBP1-84741] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ESYT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ESYT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization ErbB3/Her3 Antibody (66223) [Unconjugated]](https://images.novusbio.com/images2/ErbB3_MAB3481_Block_Neutralize_9158.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ESYT1 |
![Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes.](http://images.novusbio.com/fullsize/FAM62A-Antibody-Immunohistochemistry-Paraffin-NBP1-84741-img0017.jpg "Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes.")
![Western Blot: FAM62A Antibody [NBP1-84741] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/FAM62A-Antibody-Western-Blot-NBP1-84741-img0011.jpg "Western Blot: FAM62A Antibody [NBP1-84741] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/FAM62A-Antibody-Immunohistochemistry-Paraffin-NBP1-84741-img0015.jpg "Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/FAM62A-Antibody-Immunohistochemistry-Paraffin-NBP1-84741-img0016.jpg "Immunohistochemistry-Paraffin: FAM62A Antibody [NBP1-84741] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Slit1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Slit1 [Unconjugated]")
![Immunocytochemistry PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Immunocytochemistry_16563.jpg)
![Western Blot PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Western_Blot_16593.jpg)
![Simple Western PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/af8520_human-psap-affinity-purified-polyclonal-ab-simple-western-13420221645.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")