Home » FALDH » FALDH Proteins » FALDH Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FALDH Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FALDH Protein (NBP1-90193PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FALDH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH3A2.

Source: E. coli

Amino Acid Sequence: SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH3A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90193.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FALDH Recombinant Protein Antigen

  • Aldehyde dehydrogenase 10
  • aldehyde dehydrogenase 3 family, member A2
  • Aldehyde dehydrogenase family 3 member A2
  • ALDH10FLJ20851
  • EC 1.2.1
  • EC 1.2.1.3
  • FALDHDKFZp686E23276
  • fatty aldehyde dehydrogenase
  • Microsomal aldehyde dehydrogenase
  • SLS

Background

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Desmocollin-3
Antibody (765129)
MAB7265
Western Blot Desmocollin-3 Antibody (765129)
Immunohistochemistry Desmocollin-3 Antibody (765129)
(1 Review)
Species: Mu
Applications: IHC, WB
Aldehyde
Dehydrogenase 3-A1/AL ...
NBP2-02483
Western Blot Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (OTI1B6)
Flow Cytometry Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (OTI1B6)
Western Blot Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (OTI1B6)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Afamin Antibody
NBP1-89156
Immunohistochemistry-Paraffin Afamin Antibody
Immunohistochemistry-Paraffin Afamin Antibody
Immunohistochemistry-Paraffin Afamin Antibody
Species: Hu
Applications: IHC, IHC-P
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
Gastrin Antibody
NBP3-12223
Immunohistochemistry-Paraffin Gastrin Antibody
Unknown Gastrin Antibody
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Immunocytochemistry/ Immunofluorescence N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PA1 Antibody
NBP1-06542
Immunohistochemistry PA1 Antibody
Immunohistochemistry-Paraffin PA1 Antibody
Western Blot PA1 Antibody
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
PKD2L1 Antibody
(4F9)
H00009033-M01
Western Blot PKD2L1 Antibody (4F9)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
VEGFR3/Flt-4
Antibody [Unconjugate
AF743
Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]
(3 Reviews)
(140 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, WB
USH1G Antibody
NBP1-89076
Immunohistochemistry-Paraffin USH1G Antibody
(1 Publication)
Species: Ca, Hu
Applications: IHC, IHC-P, WB
B7-2/CD86 Antibody
(BU63)
NBP2-25208
Knockout Validated B7-2/CD86 Antibody (BU63)
Immunocytochemistry/ Immunofluorescence B7-2/CD86 Antibody (BU63)
Flow Cytometry B7-2/CD86 Antibody (BU63)
(27 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
FALDH Recombinant
Protein Antigen
NBP1-90193PEP
FALDH Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FALDH Protein (NBP1-90193PEP) (0)

There are no publications for FALDH Protein (NBP1-90193PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FALDH Protein (NBP1-90193PEP) (0)

There are no reviews for FALDH Protein (NBP1-90193PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FALDH Protein (NBP1-90193PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FALDH Products

Research Areas for FALDH Protein (NBP1-90193PEP)

Find related products by research area.

Blogs on FALDH

There are no specific blogs for FALDH, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FALDH Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ALDH3A2