Novus Biologicals products are now on bio-techne.com

Factor V Recombinant Protein Antigen

Images

 
There are currently no images for Factor V Protein (NBP1-88114PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Factor V Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human F5.

Source: E. coli

Amino Acid Sequence: MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
F5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88114.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Factor V Recombinant Protein Antigen

  • Activated protein C cofactor
  • Cf5
  • Cf-5
  • Coagulation Factor 5
  • coagulation factor V (proaccelerin, labile factor)
  • coagulation factor V jinjiang A2 domain
  • Coagulation Factor V
  • F5
  • factor V Leiden
  • Factor V
  • FVL
  • PCCF
  • Proaccelerin, Labile Factor
  • RPRGL1
  • THPH2

Background

The F5 gene encodes a 2,224 amino acid long, 251 kDA coagulation factor V protein that is critical in the regulation of homeostasis. Additionally, F5 functions as a cofactor for the prothrombinase activity of factor Xa which results in the initiation of prothrombin to thrombin. F5 participates in blood coagulation signaling pathways, the blood clotting cascade, platelet degranulation as well as activation, signaling, and aggregation, and in responses to elevated platelet cytosolic Ca2+. It interacts with genes PROC, PROS1, F2, MMRN1, and CALR. Defects in F5 cause factor 5 deficiency (owren parahemophilia), thrombophilia due to activated protein C resistance, susceptibility to Budd-Chiari syndrome, susceptibility to ischemic strokes, and susceptibility to pregnancy loss, recurrent, type 1. F5 is also linked to deep vein thrombosis, antithrombin III deficiency, retinal vein occlusion, legg-calve-perthes disease, liver disease, hypertension, pulmonary embolism, lupus, and patent foramen ovale.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1267
Species: Hu
Applications: IP, Neut, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF2338
Species: Hu
Applications: ICC, IP, WB
NBP1-88114PEP
Species: Hu
Applications: AC

Publications for Factor V Protein (NBP1-88114PEP) (0)

There are no publications for Factor V Protein (NBP1-88114PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor V Protein (NBP1-88114PEP) (0)

There are no reviews for Factor V Protein (NBP1-88114PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Factor V Protein (NBP1-88114PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Factor V Products

Blogs on Factor V.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Factor V Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol F5