EYS/RP25 Recombinant Protein Antigen

Name: EYS/RP25 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-90038PEP
Price: 279 USD

Images

There are currently no images for EYS/RP25 Protein (NBP1-90038PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

EYS/RP25 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EYS. Source: E. coli Amino Acid Sequence: CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	EYS
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90038. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EYS/RP25 Recombinant Protein Antigen

C6orf178
C6orf179
C6orf180
dJ22I17.2
dJ303F19.1
EGFL10
EGFL11
EGF-like-domain, multiple 10
EGF-like-domain, multiple 11
eyes shut homolog (Drosophila)
protein spacemaker homolog

Background

LOC442228 - similar to dJ22I17.2 (novel protein with EGF-like and laminin G domains)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SPAM1 Antibody -
Azide and BSA Free

NBP2-93736

Western Blot SPAM1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence SPAM1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

PNR/NR2E3 Antibody
(H7223) [Unconjugated ...

PP-H7223-00

(11 Publications)

Species: Hu

Applications: DirELISA, IHC, WB

CRB1 Antibody -
BSA Free

NBP2-56113

Species: Hu

Applications: IHC, IHC-P

Mer Antibody
[Unconjugated]

AF591

Immunohistochemistry Mer Antibody [Unconjugated]

Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]

(2 Reviews)

(71 Publications)

Species: Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC

ABCA4 Antibody
(3F4) - Azide Free

NBP1-30032

Immunohistochemistry ABCA4 Antibody (3F4) - Azide Free

(1 Review)

(5 Publications)

Species: Bv, Ca, Fe, Hu, Mu, Xp

Applications: ICC/IF, IHC, IHC-Fr, KO, WB

PDE6A Antibody -
BSA Free

NBP1-87312

(6 Publications)

Species: Hu, Pm, Mu

Applications: IHC, IHC-Fr, IHC-P, WB

RPGR Antibody -
Azide and BSA Free

NBP2-93653

Immunohistochemistry-Paraffin RPGR Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

RIMS1 Antibody

NBP3-30337

Species: Hu, Mu

Applications: WB

Mas Antibody - BSA
Free

NBP1-78444

Immunocytochemistry/ Immunofluorescence Mas Antibody - BSA Free

Immunohistochemistry Mas Antibody - BSA Free

(2 Reviews)

(21 Publications)

Species: Hu, Mu, Pm, Rb, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

RB1 Antibody
(607121) [Unconjugate

MAB6495

Immunocytochemistry RB1 Antibody (607121) [Unconjugated]

Simple Western RB1 Antibody (607121) [Unconjugated]

(5 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

Gigaxonin Antibody
- BSA Free

NBP1-49924

Western Blot Gigaxonin Antibody - BSA Free

(1 Publication)

Species: Hu

Applications: ICC/IF, IP, WB

PD-ECGF/Thymidine
Phosphorylase Antibod ...

NB100-2737

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IP, WB

ELOVL4 Antibody -
Azide and BSA Free

NBP3-03895

Immunocytochemistry/ Immunofluorescence ELOVL4 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

PTGFR Antibody -
BSA Free

NLS1049

Immunocytochemistry/ Immunofluorescence PTGFR Antibody - BSA Free

(2 Publications)

Species: Eq, Hu, Pm, Po, Pm

Applications: ICC, ICC/IF, IHC, IHC-P

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Ceramide Kinase
Antibody - BSA Free

NB100-2911

Immunocytochemistry/ Immunofluorescence Ceramide Kinase Antibody - BSA Free

(3 Publications)

Species: Hu, Mu

Applications: ICC/IF, WB

SDHA Antibody
(GT20710)

NBP3-13522

Immunocytochemistry/ Immunofluorescence SDHA Antibody (GT20710)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Agrin
[Unconjugated]

550-AG

(27 Publications)

Species: Rt

Applications: BA, BA

Publications for EYS/RP25 Protein (NBP1-90038PEP) (0)

There are no publications for EYS/RP25 Protein (NBP1-90038PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYS/RP25 Protein (NBP1-90038PEP) (0)

There are no reviews for EYS/RP25 Protein (NBP1-90038PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EYS/RP25 Protein (NBP1-90038PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EYS/RP25 Products

Blogs on EYS/RP25

There are no specific blogs for EYS/RP25, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).

Mer Antibody [Unconjugated]
AF591

Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.

NOD2 Antibody (2D9) - BSA Free
NB100-524

Simple Western: Mas Antibody [NBP1-78444] - Lane view shows a specific band for MAS1 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Mas Antibody - BSA Free
NBP1-78444

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our EYS/RP25 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

EYS

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

EYS/RP25 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

EYS/RP25 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for EYS/RP25 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for EYS/RP25 Protein (NBP1-90038PEP) (0)

Reviews for EYS/RP25 Protein (NBP1-90038PEP) (0)

FAQs for EYS/RP25 Protein (NBP1-90038PEP) (0)

Additional EYS/RP25 Products

Blogs on EYS/RP25

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics