Eosinophil derived neurotoxin Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
RNASE2 (NP_002925.1, 1 a.a. - 161 a.a.) full-length human protein. MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
Specificity |
RNASE2 - ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin), |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
RNASE2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Eosinophil derived neurotoxin Antibody
Background
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: WB
Publications for Eosinophil derived neurotoxin Antibody (H00006036-B01P) (0)
There are no publications for Eosinophil derived neurotoxin Antibody (H00006036-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Eosinophil derived neurotoxin Antibody (H00006036-B01P) (0)
There are no reviews for Eosinophil derived neurotoxin Antibody (H00006036-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Eosinophil derived neurotoxin Antibody (H00006036-B01P). (Showing 1 - 1 of 1 FAQ).
-
Do you have information as to what epitope these antibodies bind to (H00006036-D01P and H00006036-B01P)? Also, for developing an ELISA method, do you have a recommended concentration to use these antibodies at?
- FYI, these two antibodies used the same immunogen (RNASE2 [NP_002925.1, 1 a.a. ~ 161 a.a] full-length human protein) to raise the polyclonal antibodies in rabbit (H00006036-D01P) and mouse (H00006036-B01P); and this is only different between them. Since they are polyclonal ones, the epitopes should cover the entire immunogens. Unfortunately, these two antibodies have never been tested together, as a pair, in sandwich-type ELISA (sELISA). They are more expected to work individually as the detection antibodies in ELISA. The users will need to test whether they can work together in the sELISA setting; apologize for any inconvenience. The datasheet for H00006036-B01P says that it is recommended to use dilution 1:100-1:2000 in ELISA. I anticipate that H00006036-D01P should use the similar dilution in ELISA too. In our experiences, sELISA has better to have a monoclonal antibody (or the antibody raised from a smaller immunogen) as the capture antibody, where a polyclonal (or the larger immunogen-derived antibody) as the detection one; so that the protein target is anchored to the surface by using the smaller region/less epitopes while the rest of epitopes can be used by the detection antibody.
Secondary Antibodies
| |
Isotype Controls
|
Additional Eosinophil derived neurotoxin Products
Research Areas for Eosinophil derived neurotoxin Antibody (H00006036-B01P)
Find related products by research area.
|
Blogs on Eosinophil derived neurotoxin