![Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in control (vector only transfected HEK293T lysate) and EMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/EMP2-Antibody-Western-Blot-NBP1-86847-img0014.jpg "Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in control (vector only transfected HEK293T lysate) and EMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EMP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/26/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for EMP2 Antibody (NBP1-86847)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EMP2 |
![Immunocytochemistry/Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/EMP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86847-img0008.jpg "Immunocytochemistry/Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86847-img0015.jpg "Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.")
![Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.](http://images.novusbio.com/fullsize/EMP2-Antibody-Western-Blot-NBP1-86847-img0005.jpg "Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.")
![Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize/EMP2-Antibody-Western-Blot-NBP1-86847-img0007.jpg "Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.")
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human skin shows moderate to strong positivity in plasma membrane in keratinocytes.](http://images.novusbio.com/fullsize/EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86847-img0012.jpg "Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human skin shows moderate to strong positivity in plasma membrane in keratinocytes.")
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86847-img0013.jpg "Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.](http://images.novusbio.com/fullsize/EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86847-img0016.jpg "Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.")
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![Intracellular Staining by Flow Cytometry EMP3 Antibody (439949) [Unconjugated]](https://images.novusbio.com/images2/EMP3_MAB4505_Flow_Cytometry_8469.jpg)
![Intracellular Staining by Flow Cytometry EMP3 Antibody (439949) [Unconjugated]](https://images.novusbio.com/images/antibody/mab4505_human-emp3-mab-clone-439949-intracellular-staining-by-flow-cytometry-1782023142644.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20610.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20611.jpg)
![Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Immunocytochemistry__Immunofluorescence_17423.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
