Novus Biologicals products are now on bio-techne.com

EDNRA/Endothelin R Type A Antibody (2A5)

Name: EDNRA/Endothelin R Type A Antibody (2A5)
Brand: Novus Biologicals
SKU: H00001909-M02
Price: 519 USD

Submit a Review

Images

(

Enlarge)

Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 ...read more

Sandwich ELISA: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Detection limit for recombinant GST tagged EDNRA is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA
Clone	2A5
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EDNRA/Endothelin R Type A Antibody (2A5) Summary

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Specificity	EDNRA - endothelin receptor type A (2A5)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	EDNRA
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Sandwich ELISA 1:100-1:2000 Western Blot 1:500
Application Notes	Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)

EDNRA
endothelin receptor type A
endothelin-1 receptor
endothelin-1-specific receptor
ET1-specific type
ETAR
ETRA
G protein-coupled receptor
hET-AR

Background

Endothelins are a family of peptides that are potent vasoconstrictors produced by mammalian vascular endothelial cells. The receptors for endothelins are widely expressed on tissues. This sheep antibody recognizes epitopes on the cytoplasmic region of the ET(A) Receptor. The binding of this antibody does not interfere with the function of the receptor so that endothelins can interact with the receptor while the antibody is present.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EDNRB/Endothelin R
Type B Antibody - BSA ...

NLS54

(3 Publications)

Species: Ca, Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

Endothelin-1 [HRP]

QET00B

(48 Publications)

Species: Hu

Applications: ELISA

Endothelin-3
Antibody (2A6-2A4)

H00001908-M01

Western Blot Endothelin-3 Antibody (2A6-2A4)

Immunoprecipitation Endothelin-3 Antibody (2A6-2A4)

(2 Publications)

Species: Hu

Applications: ELISA, IP, WB

Endothelin 2
Antibody

NBP1-87942

Immunocytochemistry/ Immunofluorescence Endothelin 2 Antibody

Immunohistochemistry-Paraffin Endothelin 2 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Serpin
A8/Angiotensinogen An ...

NBP1-30027

Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(817 Publications)

Species: Hu

Applications: BA

ECE-1 Antibody

AF1784

Intracellular Staining by Flow Cytometry ECE-1 Antibody

(8 Publications)

Species: Hu

Applications: CyTOF-ready, IHC, IP, ICFlow, WB

iNOS Antibody -
BSA Free

NB300-605

(3 Reviews)

(130 Publications)

Species: Hu, Mu, Po, Rt

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

PRRT2 Antibody -
BSA Free

NBP2-82026

Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free

Immunohistochemistry PRRT2 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

VEGF [HRP]

DVE00

(684 Publications)

Species: Hu

Applications: ELISA

eNOS Antibody -
BSA Free

NB300-500

Immunohistochemistry-Paraffin eNOS Antibody - BSA Free

(3 Reviews)

(28 Publications)

Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh

Applications: IHC, IHC-Fr, IHC-P, WB

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

ACE/CD143 Antibody
[Unconjugated]

AF1513

Western Blot ACE/CD143 Antibody [Unconjugated]

Simple Western ACE/CD143 Antibody [Unconjugated]

(1 Review)

(7 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Band 3 Antibody

NBP2-49409

Immunohistochemistry-Paraffin Band 3 Antibody

Species: Hu

Applications: IHC, IHC-P

Biliverdin
Reductase B/BLVRB Ant

NBP1-83435

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

Angiogenin [HRP]

DAN00

(23 Publications)

Species: Hu

Applications: ELISA

SGSM3 Antibody

NBP2-13304

Immunocytochemistry/ Immunofluorescence SGSM3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional EDNRA/Endothelin R Type A Products

Research Areas for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Find related products by research area.

Blogs on EDNRA/Endothelin R Type A

There are no specific blogs for EDNRA/Endothelin R Type A, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our EDNRA/Endothelin R Type A Antibody (2A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol	EDNRA
Entrez	1909(Human)
Uniprot	AAH22511()

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

EDNRA/Endothelin R Type A Antibody (2A5)

Species Glossary

Images

Product Details

Order Details

EDNRA/Endothelin R Type A Antibody (2A5) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

Reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

Product General Protocols

Video Protocols

FAQs for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

Secondary Antibodies

Isotype Controls

Additional EDNRA/Endothelin R Type A Products

Research Areas for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Blogs on EDNRA/Endothelin R Type A

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics