Home » DSS1 » DSS1 Proteins » DSS1 Recombinant Protein Antigen

DSS1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DSS1 Recombinant Protein Antigen (NBP2-57559PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

DSS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DSS1.

Source: E. coli

Amino Acid Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57559.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DSS1 Recombinant Protein Antigen

  • 26S proteasome complex subunit DSS1
  • Deleted in split hand/split foot protein 1
  • deleted in split-hand/split-foot 1
  • DSS1Split hand/foot malformation type 1 protein
  • ECD
  • SEM1
  • Shfdg1
  • SHSF1SHFD1
  • Split hand/foot deleted protein 1
  • split hand/foot malformation (ectrodactyly) type 1

Background

The product of the DSS1 gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
NEU-1/Sialidase-1
Antibody (OTI3D4)
NBP2-46152
Immunohistochemistry NEU-1/Sialidase-1 Antibody (OTI3D4)
Immunohistochemistry NEU-1/Sialidase-1 Antibody (OTI3D4)
Immunohistochemistry NEU-1/Sialidase-1 Antibody (OTI3D4)
Species: Hu
Applications: IHC, IHC-P, WB
Cytochrome P450
1A1/1A2 Antibody (MC1
NB100-74398
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
(1 Review)
(2 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SCD-1 Antibody
[Unconjugated]
AF7550
Western Blot SCD-1 Antibody [Unconjugated]
Knockout Validated SCD-1 Antibody [Unconjugated]
Knockout Validated SCD-1 Antibody [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: IP, KO, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
FSHR Antibody
(6E8.2F5) - BSA Free
NBP2-36489
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
(8 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
TLR3 Antibody
(40C1285.6) - BSA Fre
NBP2-24875
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
Western Blot TLR3 Antibody (40C1285.6) - BSA Free
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
(90 Publications)
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
TSHR Antibody
(484405) [Unconjugate
MAB6534
Western Blot TSHR Antibody (484405) [Unconjugated]
ELISA TSHR Antibody (484405) [Unconjugated]
Species: Hu
Applications: ELISA, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(71 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(861 Publications)
Species: Hu
Applications: BA
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
DLX5 Antibody
NBP1-85793
Immunocytochemistry/ Immunofluorescence DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AHRR Antibody
NBP3-41281
Western Blot AHRR Antibody
Immunohistochemistry-Paraffin AHRR Antibody
Species: Hu
Applications: WB
DSS1 Recombinant
Protein Antigen
NBP2-57559PEP
DSS1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DSS1 Recombinant Protein Antigen (NBP2-57559PEP) (0)

There are no publications for DSS1 Recombinant Protein Antigen (NBP2-57559PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSS1 Recombinant Protein Antigen (NBP2-57559PEP) (0)

There are no reviews for DSS1 Recombinant Protein Antigen (NBP2-57559PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DSS1 Recombinant Protein Antigen (NBP2-57559PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DSS1 Products

Blogs on DSS1

There are no specific blogs for DSS1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DSS1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SEM1