Home » DEC-205/CD205 » DEC-205/CD205 Proteins » DEC-205/CD205 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DEC-205/CD205 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DEC-205/CD205 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Renal Cell Carcinoma (gp200).

Source: E. coli

Amino Acid Sequence: QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LY75
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58339.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DEC-205/CD205 Recombinant Protein Antigen

  • CD205
  • CLEC13B
  • C-type lectin domain family 13 member B
  • DEC205
  • DEC-205
  • GP200-MR6
  • Ly75
  • Ly-75
  • Lymphocyte antigen 75

Background

Predicted to enable signaling receptor activity. Predicted to be involved in immune response and inflammatory response. Located in extracellular exosome. [provided by Alliance of Genome Resources, Apr 2022]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CD11c Antibody
(AP-MAB0806) - Azide ...
NB110-97871
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
B7-2/CD86 Antibody
(BU63)
NBP2-25208
Knockout Validated B7-2/CD86 Antibody (BU63)
Immunocytochemistry/ Immunofluorescence B7-2/CD86 Antibody (BU63)
Flow Cytometry B7-2/CD86 Antibody (BU63)
(27 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]
Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]
Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]
(26 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(36 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
DC-SIGN/CD209
Antibody (120507) [Un ...
MAB161
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
(1 Review)
(47 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(455 Publications)
Species: Hu
Applications: BA
DC-LAMP Antibody
(1010E1.01)
DDX0191P-100
Immunohistochemistry DC-LAMP Antibody (1010E1.01)
Immunohistochemistry DC-LAMP Antibody (1010E1.01)
Immunohistochemistry-Paraffin DC-LAMP Antibody (1010E1.01)
(1 Review)
(53 Publications)
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P
Ovalbumin Antibody
NB600-922
Western Blot Ovalbumin Antibody
Western Blot Ovalbumin Antibody
Western Blot Ovalbumin Antibody
(10 Publications)
Species: Ch
Applications: ELISA, IHC, Single-Cell Western, WB
Langerin/CD207
Antibody (929F3.01)
DDX0362P-100
Immunohistochemistry-Frozen Langerin/CD207 Antibody (929F3.01)
Immunohistochemistry Langerin/CD207 Antibody (929F3.01)
Immunocytochemistry/ Immunofluorescence Langerin/CD207 Antibody (929F3.01)
(74 Publications)
Species: Eq, Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP) (0)

There are no publications for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP) (0)

There are no reviews for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEC-205/CD205 Products

Research Areas for DEC-205/CD205 Recombinant Protein Antigen (NBP2-58339PEP)

Find related products by research area.

Blogs on DEC-205/CD205

There are no specific blogs for DEC-205/CD205, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DEC-205/CD205 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LY75