Home » DAZL » DAZL Proteins » DAZL Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DAZL Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DAZL Protein (NBP1-85307PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DAZL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAZL.

Source: E. coli

Amino Acid Sequence: PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DAZL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85307.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAZL Recombinant Protein Antigen

  • DAZHSPGY-like-autosomal
  • DAZL1DAZ-like autosomal
  • DAZLA
  • Deleted in azoospermia-like 1
  • deleted in azoospermia-like
  • germline specific RNA binding protein
  • MGC26406
  • spermatogenesis gene on the Y-like autosomal
  • SPGYLADAZ homolog

Background

DAZL is a RNA-binding protein, which is essential for gametogenesis. Plays a central role during spermatogenesis. May act by binding to the 3'-UTR of mRNA and thereby regulating the translation of key transcripts

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DAZ1 Antibody
(3G10)
H00001617-M01
Western Blot DAZ1 Antibody (3G10)
Immunocytochemistry/ Immunofluorescence DAZ1 Antibody (3G10)
Immunohistochemistry-Paraffin DAZ1 Antibody (3G10)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(73 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Boll Antibody
NBP2-33538
Immunohistochemistry-Paraffin Boll Antibody
Immunohistochemistry-Paraffin Boll Antibody
Immunohistochemistry-Paraffin Boll Antibody
Species: Hu
Applications: IHC, IHC-P, WB
VASA Antibody
[Unconjugated]
AF2030
Western Blot VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
(56 Publications)
Species: Hu
Applications: IHC, WB
SCP3/SYCP3
Antibody - BSA Free
NB300-232
Western Blot SCP3/SYCP3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SCP3/SYCP3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SCP3/SYCP3 Antibody - BSA Free
(2 Reviews)
(82 Publications)
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PUM2 Antibody
NB100-387
Western Blot PUM2 Antibody
Western Blot PUM2 Antibody
Western Blot PUM2 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IP, WB
STRA8 Antibody
NBP1-98492
Immunocytochemistry STRA8 Antibody
Western Blot STRA8 Antibody
Western Blot STRA8 Antibody
(3 Reviews)
Species: Hu, Mu
Applications: ICC/IF, KO, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(298 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(110 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
GDF-9
[Unconjugated]
739-G9/CF
Bioactivity GDF-9 [Unconjugated]
(14 Publications)
Species: Mu
Applications: BA
CPEB1 Antibody
NB100-1437
Western Blot CPEB1 Antibody
(3 Publications)
Species: Hu
Applications: PEP-ELISA, WB
RBMY1A1 Antibody
NBP1-32887
Immunohistochemistry-Paraffin RBMY1A1 Antibody
Western Blot RBMY1A1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Stella/Dppa3
Antibody [Unconjugate
AF2566
Immunohistochemistry Stella/Dppa3 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
Pepsinogen
C/PGC/Progastricsin A
NBP1-91011
Western Blot Pepsinogen C/PGC/Progastricsin Antibody
Western Blot Pepsinogen C/PGC/Progastricsin Antibody
Immunohistochemistry-Paraffin Pepsinogen C/PGC/Progastricsin Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
CTDSPL Antibody
NBP1-20903
Immunocytochemistry/ Immunofluorescence CTDSPL Antibody
Flow Cytometry CTDSPL Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
GDNF [Unconjugated]
212-GD
Bioactivity GDNF [Unconjugated]
SDS-PAGE GDNF [Unconjugated]
SEC-MALS GDNF [Unconjugated]
(207 Publications)
Species: Hu
Applications: Bind, BA
BLIMP1/PRDM1
Antibody (3H2-E8) - B ...
NB600-235
Immunocytochemistry/ Immunofluorescence BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
Flow Cytometry BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
Immunocytochemistry/ Immunofluorescence BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
(2 Reviews)
(52 Publications)
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for DAZL Protein (NBP1-85307PEP) (0)

There are no publications for DAZL Protein (NBP1-85307PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAZL Protein (NBP1-85307PEP) (0)

There are no reviews for DAZL Protein (NBP1-85307PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAZL Protein (NBP1-85307PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAZL Products

Blogs on DAZL

There are no specific blogs for DAZL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DAZL Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DAZL