Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | ARHGDIB (NP_001166.3, 1 a.a. - 201 a.a.) full-length human protein. MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
Specificity | ARHGDIB - Rho GDP dissociation inhibitor (GDI) beta, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | ARHGDIB |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for D4-GDI/RhoGDI2 Antibody (H00000397-B01P)Find related products by research area.
|
D4-GDI (GDP dissociation inhibitor, RhoGD12) The D4-GDI protein is a negative regulator of the Ras-related Rho family of small molecule "molecular switch" GTPases. The Rho GTPases modify cell structure and architecture via rapid changes to the actin cytoskeleton and cell membrane. M... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ARHGDIB |
Entrez |
|
Uniprot |
|