![Western Blot: CYP27A1 Antibody [NBP2-32433] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Western-Blot-NBP2-32433-img0004.jpg "Western Blot: CYP27A1 Antibody [NBP2-32433] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This CYP27A1 Antibody was developed against a recombinant protein corresponding to amino acids: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP27A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CYP27A1 Antibody (NBP2-32433)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYP27A1 |
![Immunocytochemistry/Immunofluorescence: CYP27A1 Antibody [NBP2-32433] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32433-img0006.jpg "Immunocytochemistry/Immunofluorescence: CYP27A1 Antibody [NBP2-32433] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells and in Langerhans islet cells.](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Immunohistochemistry-Paraffin-NBP2-32433-img0014.jpg "Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells and in Langerhans islet cells.")
![Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Analysis in human liver and pancreas tissues. Corresponding CYP27A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Immunohistochemistry-Paraffin-NBP2-32433-img0010.jpg "Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Analysis in human liver and pancreas tissues. Corresponding CYP27A1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Immunohistochemistry-Paraffin-NBP2-32433-img0011.jpg "Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Immunohistochemistry-Paraffin-NBP2-32433-img0012.jpg "Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CYP27A1-Antibody-Immunohistochemistry-Paraffin-NBP2-32433-img0013.jpg "Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")