![Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/CSN3-Antibody-Immunohistochemistry-Paraffin-NBP2-58781-img0010.jpg "Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYAN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CSN3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CSN3 |
![Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human lactating breast shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CSN3-Antibody-Immunohistochemistry-Paraffin-NBP2-58781-img0002.jpg "Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human lactating breast shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human colon shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/CSN3-Antibody-Immunohistochemistry-Paraffin-NBP2-58781-img0007.jpg "Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human colon shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human colon, lactating breast, liver and testis using Anti-CSN3 antibody NBP2-58781 (A) shows similar protein distribution across tissues to independent antibody NBP1-85436 (B).](http://images.novusbio.com/fullsize/CSN3-Antibody-Immunohistochemistry-Paraffin-NBP2-58781-img0008.jpg "Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human colon, lactating breast, liver and testis using Anti-CSN3 antibody NBP2-58781 (A) shows similar protein distribution across tissues to independent antibody NBP1-85436 (B).")
![Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/CSN3-Antibody-Immunohistochemistry-Paraffin-NBP2-58781-img0009.jpg "Immunohistochemistry-Paraffin: CSN3 Antibody [NBP2-58781] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")