![Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human breast, cerebral cortex, kidney and liver using Anti-CSN1S1 antibody NBP2-55090 (A) shows similar protein distribution across tissues to independent antibody NBP1-91150 (B).](http://images.novusbio.com/fullsize/Casein-Antibody-Immunohistochemistry-Paraffin-NBP2-55090-img0003.jpg "Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human breast, cerebral cortex, kidney and liver using Anti-CSN1S1 antibody NBP2-55090 (A) shows similar protein distribution across tissues to independent antibody NBP1-91150 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CSN1S1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-55090 | Applications | Species |
|---|---|---|
| Langille E In vivo Screening Reveals Epigenetic Regulation of Mammary Epithelial Lineage Integrity and Tumorigenesis Thesis 2023-01-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for Casein Antibody (NBP2-55090)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CSN1S1 |
![Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human liver.](http://images.novusbio.com/fullsize/Casein-Antibody-Immunohistochemistry-Paraffin-NBP2-55090-img0006.jpg "Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human liver.")
![Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human lactating breast shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Casein-Antibody-Immunohistochemistry-Paraffin-NBP2-55090-img0002.jpg "Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human lactating breast shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Casein-Antibody-Immunohistochemistry-Paraffin-NBP2-55090-img0004.jpg "Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human kidney.](http://images.novusbio.com/fullsize/Casein-Antibody-Immunohistochemistry-Paraffin-NBP2-55090-img0005.jpg "Immunohistochemistry-Paraffin: Casein Antibody [NBP2-55090] - Staining of human kidney.")
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")