Home » CRX/CORD2 » CRX/CORD2 Proteins » CRX/CORD2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CRX/CORD2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CRX/CORD2 Protein (NBP1-88060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CRX/CORD2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRX.

Source: E. coli

Amino Acid Sequence: PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88060.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRX/CORD2 Recombinant Protein Antigen

  • cone-rod homeobox
  • CORD2
  • CRDcone-rod homeobox protein
  • CRX
  • LCA7
  • LCA7orthodenticle homeobox 3
  • OTX3

Background

CORD2 is encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NRL Antibody
[Unconjugated]
AF2945
NRL Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: WB
SP-D [HRP]
DSFPD0
N/A SP-D [HRP]
N/A SP-D [HRP]
N/A SP-D [HRP]
(9 Publications)
Species: Hu
Applications: ELISA
GUCY2D Antibody
NBP3-12211
Immunohistochemistry-Paraffin GUCY2D Antibody
Unknown GUCY2D Antibody
Western Blot GUCY2D Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PNR/NR2E3 Antibody
(H7223) [Unconjugated ...
PP-H7223-00
Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]
Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]
(11 Publications)
Species: Hu
Applications: DirELISA, IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(97 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
ABCA4 Antibody
(3F4)
NBP1-30032
Knockout Validated ABCA4 Antibody (3F4)
Immunohistochemistry ABCA4 Antibody (3F4)
Knockout Validated ABCA4 Antibody (3F4)
(1 Review)
(5 Publications)
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Otx2 Antibody
[Unconjugated]
AF1979
Immunocytochemistry Otx2 Antibody [Unconjugated]
Immunohistochemistry Otx2 Antibody [Unconjugated]
Simple Western Otx2 Antibody [Unconjugated]
(2 Reviews)
(175 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MBL Antibody
AF2307
MBL Antibody
(9 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
RBP3 Antibody (7#)
NBP3-41163
RBP3 Antibody (7#)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AIPL1 Antibody
(OTI3B4)
NBP2-01327
Flow Cytometry AIPL1 Antibody (OTI3B4)
Western Blot AIPL1 Antibody (OTI3B4)
Immunohistochemistry-Paraffin AIPL1 Antibody (OTI3B4)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CRB1 Antibody
NBP2-56113
Immunohistochemistry-Paraffin CRB1 Antibody
Immunohistochemistry-Paraffin CRB1 Antibody
Immunohistochemistry-Paraffin CRB1 Antibody
Species: Hu
Applications: IHC, IHC-P
DC-SIGN/CD209
Antibody (120507) [Un ...
MAB161
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
(1 Review)
(47 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
NHS Antibody (6D9)
H00004810-M05
ELISA NHS Antibody (6D9)
Immunocytochemistry/ Immunofluorescence NHS Antibody (6D9)
Species: Hu
Applications: ELISA, ICC/IF, WB
ERG Antibody - BSA
Free
NBP2-60655
Immunocytochemistry/ Immunofluorescence ERG Antibody - BSA Free
Western Blot ERG Antibody - BSA Free
Immunohistochemistry-Paraffin ERG Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB

Publications for CRX/CORD2 Protein (NBP1-88060PEP) (0)

There are no publications for CRX/CORD2 Protein (NBP1-88060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRX/CORD2 Protein (NBP1-88060PEP) (0)

There are no reviews for CRX/CORD2 Protein (NBP1-88060PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRX/CORD2 Protein (NBP1-88060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRX/CORD2 Products

Blogs on CRX/CORD2

There are no specific blogs for CRX/CORD2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Otx2 was detected in immersion fixed NTera-2 human testicular embryonic carcinoma cell line using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Otx2 Antibody [Unconjugated]
AF1979

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRX/CORD2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CRX