Home » CRHBP » CRHBP Proteins » CRHBP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CRHBP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CRHBP Protein (NBP1-91811PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CRHBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRHBP.

Source: E. coli

Amino Acid Sequence: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRHBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91811.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRHBP Recombinant Protein Antigen

  • corticotropin releasing hormone binding protein
  • corticotropin-releasing factor-binding protein
  • Corticotropin-releasing hormone-binding protein
  • CRFBP
  • CRFBPcorticotropin releasing hormone-binding protein
  • CRF-BPCRF-binding protein
  • CRHBP
  • CRH-BP

Background

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Corticotropin
Releasing Factor Anti ...
H00001392-M02
Western Blot Corticotropin Releasing Factor Antibody (2B11)
Sandwich ELISA Corticotropin Releasing Factor Antibody (2B11)
(4 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
C1QL1
[Unconjugated]
9134-TN
Bioactivity C1QL1 [Unconjugated]
Species: Hu
Applications: BA
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CRHR1/CRF1 Antibody
NBP1-00175
Immunocytochemistry/ Immunofluorescence CRHR1/CRF1 Antibody
Immunocytochemistry/ Immunofluorescence CRHR1/CRF1 Antibody
Western Blot CRHR1/CRF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
Urocortin Antibody
(749606)
MAB7447
Western Blot Urocortin Antibody (749606)
Immunohistochemistry Urocortin Antibody (749606)
(2 Publications)
Species: Hu
Applications: IHC, WB
CRHR2/CRF2 Antibody
NB100-56485
Simple Western CRHR2/CRF2 Antibody
Western Blot CRHR2/CRF2 Antibody
(1 Review)
(4 Publications)
Species: Bv, Ca, Ch, Hu, Ma, Mu, Rt
Applications: ICC/IF, Simple Western, WB
Heparanase/HPSE
[Unconjugated]
7570-GH
Enzyme Activity Heparanase/HPSE [Unconjugated]
SDS-PAGE Heparanase/HPSE [Unconjugated]
(13 Publications)
Species: Hu
Applications: EnzAct
Corticotropin
Releasing Factor Anti ...
H00001392-M02
Western Blot Corticotropin Releasing Factor Antibody (2B11)
Sandwich ELISA Corticotropin Releasing Factor Antibody (2B11)
(4 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Carbonic Anhydrase
VIII/CA8 Antibody [Un ...
AF2187
Western Blot Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]
Simple Western Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IP, Simple Western, WB
ANKRD1 Antibody
NBP2-15397
Immunocytochemistry/ Immunofluorescence ANKRD1 Antibody
Western Blot ANKRD1 Antibody
Western Blot ANKRD1 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
UCN2 Antibody
NBP3-12450
Immunohistochemistry-Paraffin UCN2 Antibody
Immunohistochemistry-Paraffin UCN2 Antibody
Immunohistochemistry-Paraffin UCN2 Antibody
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(670 Publications)
Species: Mu
Applications: ELISA
Urocortin 3
Antibody
NB100-93444
Western Blot Urocortin 3 Antibody
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB

Publications for CRHBP Protein (NBP1-91811PEP) (0)

There are no publications for CRHBP Protein (NBP1-91811PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRHBP Protein (NBP1-91811PEP) (0)

There are no reviews for CRHBP Protein (NBP1-91811PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRHBP Protein (NBP1-91811PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRHBP Products

Research Areas for CRHBP Protein (NBP1-91811PEP)

Find related products by research area.

Blogs on CRHBP

There are no specific blogs for CRHBP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
c-Fos Antibody (2H2)
NBP2-50037

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRHBP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CRHBP