CPT1A Antibody (3M6E9) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 520-720 of human CPT1A (NP_001867.2). WDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
CPT1A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for CPT1A Antibody (3M6E9)
Background
The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for CPT1A Antibody (NBP3-16072) (0)
There are no publications for CPT1A Antibody (NBP3-16072).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CPT1A Antibody (NBP3-16072) (0)
There are no reviews for CPT1A Antibody (NBP3-16072).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CPT1A Antibody (NBP3-16072) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CPT1A Products
Research Areas for CPT1A Antibody (NBP3-16072)
Find related products by research area.
|
Blogs on CPT1A