Home » COX7B » COX7B Proteins » Recombinant Human COX7B GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human COX7B GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human COX7B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-80 of Human COX7B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
COX7B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX7B GST (N-Term) Protein

  • Cytochrome c oxidase polypeptide VIIb
  • cytochrome c oxidase subunit 7B, mitochondrial
  • cytochrome c oxidase subunit VIIb
  • cytochrome-c oxidase chain VIIb

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively. COX7B( AAH18386, 1 a.a. - 81 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

COX5A Antibody
NBP1-32550
Western Blot COX5A Antibody
Immunohistochemistry-Paraffin COX5A Antibody
Western Blot COX5A Antibody
(3 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
BHLHB9 Antibody
NBP2-55171
Immunocytochemistry/ Immunofluorescence BHLHB9 Antibody
Species: Hu
Applications: ICC/IF
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
IL-11 [HRP]
D1100
N/A IL-11 [HRP]
N/A IL-11 [HRP]
N/A IL-11 [HRP]
(30 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-PAGE Recombinant Human COX8A GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
COX6A2 Antibody
NBP1-31112
Western Blot COX6A2 Antibody
Immunocytochemistry/ Immunofluorescence COX6A2 Antibody
Immunohistochemistry-Paraffin COX6A2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/ Immunofluorescence CPOX Antibody (36B10) - BSA Free
Western Blot CPOX Antibody (36B10) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
Cytochrome C
Oxidase subunit 6c An ...
NBP2-45645
Immunofluorescence Cytochrome C Oxidase subunit 6c Antibody (OTI4B11)
Immunofluorescence Cytochrome C Oxidase subunit 6c Antibody (OTI4B11)
Immunohistochemistry Cytochrome C Oxidase subunit 6c Antibody (OTI4B11)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
FAK Antibody
[Unconjugated]
AF4467
Immunohistochemistry FAK Antibody [Unconjugated]
Knockout Validated FAK Antibody [Unconjugated]
Western Blot FAK Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
COX6A1 Antibody -
BSA Free
NBP2-92889
Immunocytochemistry/ Immunofluorescence COX6A1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence COX6A1 Antibody - BSA Free
Immunohistochemistry-Paraffin COX6A1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COX4 Antibody -
BSA Free
NB110-39115
Western Blot COX4 Antibody - BSA Free
Simple Western COX4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence COX4 Antibody - BSA Free
(4 Reviews)
(19 Publications)
Species: Bv, Dr, Hu, I, Mu, Ma-Op, Po, Pm, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
TOP2A Antibody
NBP1-86928
Immunohistochemistry-Paraffin TOP2A Antibody
Immunohistochemistry-Paraffin TOP2A Antibody
Immunohistochemistry-Paraffin TOP2A Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MKK4/MEK4 Antibody
(OTI8A8)
NBP1-47839
Flow Cytometry MKK4/MEK4 Antibody (OTI8A8)
Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)
Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)
(1 Review)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
COX IV Isoform 2
Antibody (1F2)
H00084701-M01
ELISA COX IV Isoform 2 Antibody (1F2)
Immunohistochemistry-Paraffin COX IV Isoform 2 Antibody (1F2)
Immunoprecipitation COX IV Isoform 2 Antibody (1F2)
(14 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ELISA, IB, IHC, IHC-P, IP, WB
Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB

Publications for COX7B Recombinant Protein (H00001349-P01) (0)

There are no publications for COX7B Recombinant Protein (H00001349-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX7B Recombinant Protein (H00001349-P01) (0)

There are no reviews for COX7B Recombinant Protein (H00001349-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX7B Recombinant Protein (H00001349-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX7B Products

Array H00001349-P01

Blogs on COX7B

There are no specific blogs for COX7B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX7B GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol COX7B