![Immunocytochemistry/Immunofluorescence: COX-2 Antibody [NBP1-85499] - Staining of human cell line A549 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/COX-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85499-img0004.jpg "Immunocytochemistry/Immunofluorescence: COX-2 Antibody [NBP1-85499] - Staining of human cell line A549 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTGS2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COX-2 Antibody (NBP1-85499)Find related products by research area.
|
|
Immune Cell Metabolic Flux Influences Type I Diabetes By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev... Read full blog post. |
|
Increased wild type FUS levels in ALS patients lead to a toxic microenvironment and motor neuron neurodegeneration By Michalina Hanzel, PhDFUS mutations in Amyotrophic Lateral SclerosisFused in sarcoma (FUS) is a ribonucleoprotein that continuously shuttles between the nucleus and the cytoplasm to regulate pre-mRNA splicing, mRN... Read full blog post. |
|
SUCNR1/GPR91 - a potential role in renovascular hypertension SUCNR1 is the cognate receptor for the Kreb's citric acid cycle intermediate succinate. It is of interest to scientists because it is involved in not only energy metabolism but possibly also in renovascular hypertension, a condition linked to diabe... Read full blog post. |
|
Inhibitor kappa B-alpha (IkappaB-alpha) The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTGS2 |
![Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining in human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/COX-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85499-img0003.jpg "Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining in human urinary bladder shows strong cytoplasmic positivity in urothelial cells.")
![Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human skeletal muscle shows no postivity in myocytes as expected.](http://images.novusbio.com/fullsize/COX-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85499-img0006.jpg "Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human skeletal muscle shows no postivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human kidney shows not postivity in cells in tubules and cells in glomeruli as expected.](http://images.novusbio.com/fullsize/COX-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85499-img0007.jpg "Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human kidney shows not postivity in cells in tubules and cells in glomeruli as expected.")
![Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human seminal vesicle shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/COX-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85499-img0008.jpg "Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human seminal vesicle shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/COX-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85499-img0009.jpg "Immunohistochemistry-Paraffin: COX-2 Antibody [NBP1-85499] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")