![Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining in human skin and pancreas tissues using anti-CDSN antibody. Corresponding CDSN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Corneodesmosin-Antibody-Immunohistochemistry-Paraffin-NBP2-47501-img0005.jpg "Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining in human skin and pancreas tissues using anti-CDSN antibody. Corresponding CDSN RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDSN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
| Publication using NBP2-47501 | Applications | Species |
|---|---|---|
| Ipponjima S, Umino Y, Nagayama M, Denda M Live imaging of alterations in cellular morphology and organelles during cornification using an epidermal equivalent model Sci Rep 2020-03-26 [PMID: 32218450] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDSN |
![Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human kidney, liver, pancreas and skin using Anti-CDSN antibody NBP2-47501 (A) shows similar protein distribution across tissues to independent antibody NBP2-37942 (B).](http://images.novusbio.com/fullsize/Corneodesmosin-Antibody-Immunohistochemistry-Paraffin-NBP2-47501-img0012.jpg "Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human kidney, liver, pancreas and skin using Anti-CDSN antibody NBP2-47501 (A) shows similar protein distribution across tissues to independent antibody NBP2-37942 (B).")
![Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Corneodesmosin-Antibody-Immunohistochemistry-Paraffin-NBP2-47501-img0013.jpg "Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Corneodesmosin-Antibody-Immunohistochemistry-Paraffin-NBP2-47501-img0003.jpg "Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human skin shows membranous positivity in stratum corneum and stratum granulosum.](http://images.novusbio.com/fullsize/Corneodesmosin-Antibody-Immunohistochemistry-Paraffin-NBP2-47501-img0008.jpg "Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human skin shows membranous positivity in stratum corneum and stratum granulosum.")
![Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/Corneodesmosin-Antibody-Immunohistochemistry-Paraffin-NBP2-47501-img0011.jpg "Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Western_Blot_21474.jpg)
![Immunohistochemistry Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Immunohistochemistry_6755.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")