Home » Contactin-5 » Contactin-5 Proteins » Contactin-5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Contactin-5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Contactin-5 Protein (NBP1-83242PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Contactin-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNTN5.

Source: E. coli

Amino Acid Sequence: KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CNTN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83242.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Contactin-5 Recombinant Protein Antigen

  • CNTN5
  • contactin 5
  • Contactin5
  • Contactin-5
  • hNB-2
  • HNB-2s
  • MGC163491
  • NB2
  • NB-2
  • neural adhesion molecule
  • Neural recognition molecule NB-2

Background

CNTN5 is encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.; ; Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity in the cerebral cortical neurons but not in hippocampal neurons. Involved in neuronal activity in the auditory system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM49B Antibody
NBP1-88582
Western Blot FAM49B Antibody
Immunohistochemistry-Paraffin FAM49B Antibody
Immunocytochemistry/ Immunofluorescence FAM49B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
L1CAM Antibody
(UJ127.11) - BSA Free
NB100-2682
Flow Cytometry L1CAM Antibody (UJ127.11) - BSA Free
Western Blot L1CAM Antibody (UJ127.11) - BSA Free
Immunohistochemistry-Paraffin L1CAM Antibody (UJ127.11) - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Contactin-2/TAG1
Antibody [Unconjugate ...
AF4439
Immunohistochemistry Contactin-2/TAG1 Antibody [Unconjugated]
Simple Western Contactin-2/TAG1 Antibody [Unconjugated]
Western Blot Contactin-2/TAG1 Antibody [Unconjugated]
(43 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Contactin-1
Antibody [Unconjugate
AF904
Western Blot Contactin-1 Antibody [Unconjugated]
Immunohistochemistry Contactin-1 Antibody [Unconjugated]
Neutralization Contactin-1 Antibody [Unconjugated]
(22 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(26 Publications)
Species: Hu
Applications: ELISA
Contactin-4
Antibody
AF5495
Western Blot Contactin-4 Antibody
Immunohistochemistry Contactin-4 Antibody
(1 Publication)
Species: Mu
Applications: IHC, WB
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(19 Publications)
Species: Rt
Applications: BA
Contactin-3
Antibody [Unconjugate
AF5539
Western Blot Contactin-3 Antibody [Unconjugated]
Immunocytochemistry Contactin-3 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SIRP alpha/CD172a
Antibody (OX-41)
NB100-65530
Immunofluorescence SIRP alpha/CD172a Antibody (OX-41)
Immunofluorescence SIRP alpha/CD172a Antibody (OX-41)
Immunofluorescence SIRP alpha/CD172a Antibody (OX-41)
(5 Publications)
Species: Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Contactin-6
Antibody [Unconjugate
AF5890
Western Blot Contactin-6 Antibody [Unconjugated]
Immunohistochemistry Contactin-6 Antibody [Unconjugated]
Simple Western Contactin-6 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
CHL-1/L1CAM-2
Antibody [Unconjugate
AF2147
Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]
Simple Western CHL-1/L1CAM-2 Antibody [Unconjugated]
Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]
(1 Review)
(25 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DSCAM Antibody
[Unconjugated] - Long ...
AF3666
Western Blot DSCAM Antibody [Unconjugated] - Long Isoform
Immunocytochemistry DSCAM Antibody [Unconjugated] - Long Isoform
Western Blot DSCAM Antibody [Unconjugated] - Long Isoform
(6 Publications)
Species: Hu
Applications: ICC, WB
Contactin-5
Recombinant Protein A
NBP1-83242PEP
Contactin-5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Contactin-5 Protein (NBP1-83242PEP) (0)

There are no publications for Contactin-5 Protein (NBP1-83242PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Contactin-5 Protein (NBP1-83242PEP) (0)

There are no reviews for Contactin-5 Protein (NBP1-83242PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Contactin-5 Protein (NBP1-83242PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Contactin-5 Products

Research Areas for Contactin-5 Protein (NBP1-83242PEP)

Find related products by research area.

Blogs on Contactin-5

There are no specific blogs for Contactin-5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
GFAP Antibody
NB300-141

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Contactin-5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CNTN5