Home » Complement C6 » Complement C6 Proteins » Complement C6 Recombinant Protein Antigen

Complement C6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Complement C6 Protein (NBP1-91803PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Complement C6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C6.

Source: E. coli

Amino Acid Sequence: GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91803.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement C6 Recombinant Protein Antigen

  • complement component 6
  • complement component C6

Background

C6 is a component of complement cascade. It is involved in the formation of the lytic C5b-9m complex. People with C6 deficiency are prone to bacterial infection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement
Component C5a [Biotin
DY2037
N/A Complement Component C5a [Biotin]
(27 Publications)
Species: Hu
Applications: ELISA
Complement C7
Antibody
H00000730-D01P
Western Blot Complement C7 Antibody
Western Blot Complement C7 Antibody
(4 Publications)
Species: Hu, Mu
Applications: WB
CXCL10/IP-10/CRG-2
[HRP]
DIP100
N/A CXCL10/IP-10/CRG-2 [HRP]
N/A CXCL10/IP-10/CRG-2 [HRP]
N/A CXCL10/IP-10/CRG-2 [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(33 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Complement C4d
Antibody (C4D204)
NBP2-34234
Immunohistochemistry-Paraffin Complement C4d Antibody (C4D204)
Immunohistochemistry-Paraffin Complement C4d Antibody (C4D204)
Immunohistochemistry-Paraffin Complement C4d Antibody (C4D204)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB
ARHGAP4 Antibody
NBP1-88527
Western Blot ARHGAP4 Antibody
Immunohistochemistry-Paraffin ARHGAP4 Antibody
Immunohistochemistry-Paraffin ARHGAP4 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PFDN4 Antibody -
Azide and BSA Free
NBP2-93935
Immunocytochemistry/ Immunofluorescence PFDN4 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PFDN4 Antibody - Azide and BSA Free
Western Blot PFDN4 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Complement
Component C9 Antibody
NBP2-15952
Immunocytochemistry/ Immunofluorescence Complement Component C9 Antibody
Western Blot Complement Component C9 Antibody
Western Blot Complement Component C9 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Aldo-keto
Reductase 1C1/AKR1C1 ...
MAB6529
Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]
Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
CDCA3 Antibody
(1J5L2)
NBP3-16514
Western Blot CDCA3 Antibody (1J5L2)
Immunohistochemistry-Paraffin CDCA3 Antibody (1J5L2)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(136 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(820 Publications)
Species: Hu
Applications: BA
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(112 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Recombinant Human
GRCC10 GST (N-Term) P ...
H00113246-P01
Other Recombinant Human GRCC10 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC

Publications for Complement C6 Protein (NBP1-91803PEP) (0)

There are no publications for Complement C6 Protein (NBP1-91803PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C6 Protein (NBP1-91803PEP) (0)

There are no reviews for Complement C6 Protein (NBP1-91803PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Complement C6 Protein (NBP1-91803PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement C6 Products

Research Areas for Complement C6 Protein (NBP1-91803PEP)

Find related products by research area.

Blogs on Complement C6

There are no specific blogs for Complement C6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Complement C6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol C6