Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, MA, AP |
Description | A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-112 of Human C5 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Partial Recombinant Protein |
Gene | C5 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Complement C5 Partial Recombinant Protein (H00000727-Q01)Find related products by research area.
|
Complement C3 - The Most Important Protein in the Complement System The complement system is made up of a collection of proteins found in the bloodstream and is comprised of nine major complement proteins; complement C3 is one of them. The complement system is a crucial component of the cellular immune system becau... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | C5 |