CNPase Antibody (CL2887) [Janelia Fluor® 646] Summary
Immunogen |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL |
Isotype |
IgG2b |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CNP |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Protein A purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for CNPase Antibody (CL2887) [Janelia Fluor® 646]
Background
2,3-cyclic nucleotide-3-phosphodiesterase (CNP) is a membrane bound, microtubule associated protein that is among the most abundant myelin proteins of the CNS. It is thought that CNP may serve as a regulator of tubulin polymerization and of microtubule distribution (Bifulco et al., 2002). It was recently found that CNP may also function as a possible linker protein anchoring microtubules to the plasma membrane via a 13 residue C-terminal CNP fragment (Bifulco et al., 2002, Esposito et al., 2008).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Rt
Applications: BA
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Publications for CNPase Antibody (NBP2-46617JF646) (0)
There are no publications for CNPase Antibody (NBP2-46617JF646).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CNPase Antibody (NBP2-46617JF646) (0)
There are no reviews for CNPase Antibody (NBP2-46617JF646).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CNPase Antibody (NBP2-46617JF646) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CNPase Products
Research Areas for CNPase Antibody (NBP2-46617JF646)
Find related products by research area.
|
Blogs on CNPase