CLCN1 Antibody (0P2M8) Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3).
Sequence: NTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
CLCN1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:2000 - 1:20000
|
Theoretical MW |
109 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for CLCN1 Antibody (0P2M8)
Background
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) whichdemonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encodedby this gene regulates the electric excitability of the skeletal muscle membrane. Mutations in this gene cause twoforms of inherited human muscle disorders: recessive generalized myotonia congenita (Becker) and dominant myotonia(Thomsen). (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: WB
Publications for CLCN1 Antibody (NBP3-33303) (0)
There are no publications for CLCN1 Antibody (NBP3-33303).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLCN1 Antibody (NBP3-33303) (0)
There are no reviews for CLCN1 Antibody (NBP3-33303).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLCN1 Antibody (NBP3-33303) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLCN1 Products
Research Areas for CLCN1 Antibody (NBP3-33303)
Find related products by research area.
|
Blogs on CLCN1