Claudin-3 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034032). Peptide sequence VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CLDN3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Claudin-3 Antibody
Background
The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Claudin expression is highly restricted to specfic regions of different tissues and variations of Claudin expression may have an important role in transcellular transport through tight junctions. In rat liver, claudin-3 is uniformly expressed, whereas in the pancreas, claudin-3 is expressed in junctions of the duct epithelia and junctions of acinar cells. Claudin-3 binds the peptide toxin Clostridium perfringens enterotoxin (CPE) at the cell surface via the second extracellular loop of claudin-3. The gene encoding human claudin-3 maps to chromosome 7q11.23.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Po
Applications: IHC, IHC-P, WB
Species: Ca, Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: WB
Publications for Claudin-3 Antibody (NBP3-10555) (0)
There are no publications for Claudin-3 Antibody (NBP3-10555).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Claudin-3 Antibody (NBP3-10555) (0)
There are no reviews for Claudin-3 Antibody (NBP3-10555).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Claudin-3 Antibody (NBP3-10555) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Claudin-3 Products
Research Areas for Claudin-3 Antibody (NBP3-10555)
Find related products by research area.
|
Blogs on Claudin-3