![Western Blot: Clathrin interactor 1 Antibody [NBP1-85570] - Analysis using Anti-CLINT1 antibody NBP1-85570 (A) shows similar pattern to independent antibody NBP2-49239 (B).](http://images.novusbio.com/fullsize/Clathrin-interactor-1-Antibody-Western-Blot-NBP1-85570-img0009.jpg "Western Blot: Clathrin interactor 1 Antibody [NBP1-85570] - Analysis using Anti-CLINT1 antibody NBP1-85570 (A) shows similar pattern to independent antibody NBP2-49239 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLINT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLINT1 |
![Western Blot: Clathrin interactor 1 Antibody [NBP1-85570] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Clathrin-interactor-1-Antibody-Western-Blot-NBP1-85570-img0008.jpg "Western Blot: Clathrin interactor 1 Antibody [NBP1-85570] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: Clathrin interactor 1 Antibody [NBP1-85570] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Clathrin-interactor-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85570-img0007.jpg "Immunocytochemistry/Immunofluorescence: Clathrin interactor 1 Antibody [NBP1-85570] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/antibody/nbp1-85570_rabbit-polyclonal-clathrin-interactor-1-antibody-immunohistochemistry-paraffin-20220249623..jpg "Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] -Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/antibody/nbp1-85570_rabbit-polyclonal-clathrin-interactor-1-antibody-immunohistochemistry-paraffin-20220249716..jpg "Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] -Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] -Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-85570_rabbit-polyclonal-clathrin-interactor-1-antibody-immunohistochemistry-paraffin-20220249815..jpg "Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] -Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-85570_rabbit-polyclonal-clathrin-interactor-1-antibody-immunohistochemistry-paraffin-2022024997..jpg "Immunohistochemistry-Paraffin: Clathrin interactor 1 Antibody [NBP1-85570] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunocytochemistry_6471.jpg)
![Western Blot FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Western_Blot_17166.jpg)
![Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunohistochemistry_7312.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")