Home » CIPAR-1 » CIPAR-1 Proteins » CIPAR-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CIPAR-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CIPAR-1 Protein (NBP1-85610PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CIPAR-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PARM1.

Source: E. coli

Amino Acid Sequence: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PARM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CIPAR-1 Recombinant Protein Antigen

  • Castration-induced prostatic apoptosis-related protein 1
  • CIPAR-1
  • Prostatic androgen-repressed message 1 protein
  • Protein PARM-1 [Precursor]

Background

Cipar1 may be involved in a survival program enabling certain prostatic cells to resist apoptosis. It is expressed in prostate and detected in other organs at low levels, these include the heart and various tissues of the urogenital tract; not detected in mammary gland.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot GADD153/CHOP Antibody (9C8)
Flow Cytometry GADD153/CHOP Antibody (9C8)
Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)
(3 Reviews)
(46 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(44 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
PP14/Glycodelin
Antibody
NBP1-89781
Immunohistochemistry-Paraffin PP14/Glycodelin Antibody
Immunohistochemistry-Paraffin PP14/Glycodelin Antibody
Western Blot PP14/Glycodelin Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Dermcidin Antibody
(G-81)
NBP1-49620
Dermcidin Antibody (G-81)
(2 Publications)
Species: Hu
Applications: IA, ICC/IF, IHC, IHC-P, WB
TEP1 Antibody -
BSA Free
NBP1-77285
Western Blot TEP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TEP1 Antibody - BSA Free
Immunohistochemistry TEP1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ADIG Antibody
NBP2-75311
Immunohistochemistry-Paraffin ADIG Antibody
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
ATF6 Antibody
(70B1413.1) - BSA Fre
NBP1-40256
Western Blot ATF6 Antibody (70B1413.1) - BSA Free
Flow (Intracellular) ATF6 Antibody (70B1413.1) - BSA Free
Immunohistochemistry-Paraffin ATF6 Antibody (70B1413.1) - BSA Free
(3 Reviews)
(246 Publications)
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Caspase-12
Antibody - BSA Free
NBP1-76801
Immunocytochemistry/ Immunofluorescence Caspase-12 Antibody - BSA Free
Western Blot Caspase-12 Antibody - BSA Free
Immunohistochemistry-Paraffin Caspase-12 Antibody - BSA Free
(2 Reviews)
(6 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Cbx8 Antibody
NBP1-83224
Immunocytochemistry/ Immunofluorescence Cbx8 Antibody
Immunohistochemistry-Paraffin Cbx8 Antibody
Immunohistochemistry-Paraffin Cbx8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACTR1B Antibody
NBP2-15275
Western Blot ACTR1B Antibody
Western Blot ACTR1B Antibody
Immunohistochemistry-Paraffin ACTR1B Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BTG2 Antibody
(OTI4C10)
NBP2-46587
Immunohistochemistry BTG2 Antibody (OTI4C10)
Immunohistochemistry BTG2 Antibody (OTI4C10)
Immunohistochemistry BTG2 Antibody (OTI4C10)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Proprotein
Convertase 1/PCSK1 An ...
H00005122-M02
Immunocytochemistry/ Immunofluorescence Proprotein Convertase 1/PCSK1 Antibody (3D2)
Immunohistochemistry-Paraffin Proprotein Convertase 1/PCSK1 Antibody (3D2)
Sandwich ELISA Proprotein Convertase 1/PCSK1 Antibody (3D2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
PERK Antibody
[Unconjugated]
AF3999
Western Blot PERK Antibody [Unconjugated]
Knockout Validated PERK Antibody [Unconjugated]
Western Blot PERK Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: KO, WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
Neuronal Pentraxin
2 Antibody - BSA Free ...
NBP1-76899
Western Blot Neuronal Pentraxin 2 Antibody - BSA Free
Immunohistochemistry Neuronal Pentraxin 2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Neuronal Pentraxin 2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for CIPAR-1 Protein (NBP1-85610PEP) (0)

There are no publications for CIPAR-1 Protein (NBP1-85610PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIPAR-1 Protein (NBP1-85610PEP) (0)

There are no reviews for CIPAR-1 Protein (NBP1-85610PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CIPAR-1 Protein (NBP1-85610PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CIPAR-1 Products

Blogs on CIPAR-1

There are no specific blogs for CIPAR-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY license.
ATF6 Antibody (70B1413.1) - BSA Free
NBP1-40256-0.1mg

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CIPAR-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PARM1