Home » Choline Kinase beta » Choline Kinase beta Peptides and Proteins » Choline Kinase beta Recombinant Protein Antigen

Choline Kinase beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Choline Kinase beta Protein (NBP1-85632PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Choline Kinase beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHKB.

Source: E. coli

Amino Acid Sequence: CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHKB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85632.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Choline Kinase beta Recombinant Protein Antigen

  • CHETK
  • CHETKcholine/ethanolamine kinase beta
  • CHKL
  • CHKLcholine kinase-like
  • ChoKB
  • Choline Kinase beta
  • choline kinase betaEK
  • Choline kinase-like protein
  • CK
  • CKB
  • CKEKB
  • CKEKBEKBcholine/ethanolamine kinase
  • EC 2.7.1.32
  • EC 2.7.1.82
  • EK
  • EKB
  • Ethanolamine Kinase beta
  • Ethanolamine kinase
  • MDCMC

Background

Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(80 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry Cytokeratin 19 Antibody - BSA Free
Western Blot Cytokeratin 19 Antibody - BSA Free
Immunohistochemistry Cytokeratin 19 Antibody - BSA Free
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
Flow Cytometry MUC1 Antibody (SM3) - BSA Free
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
(14 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(71 Publications)
Species: Hu
Applications: ELISA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ETFA Antibody
NBP1-84854
Immunocytochemistry/ Immunofluorescence ETFA Antibody
Immunohistochemistry-Paraffin ETFA Antibody
Immunohistochemistry-Paraffin ETFA Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Flow Cytometry Cytokeratin 14 Antibody (LL002)
Immunocytochemistry/ Immunofluorescence Cytokeratin 14 Antibody (LL002)
Immunohistochemistry-Paraffin Cytokeratin 14 Antibody (LL002)
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Cytokeratin 8
Antibody
NBP2-16094
Immunocytochemistry/ Immunofluorescence Cytokeratin 8 Antibody
Western Blot Cytokeratin 8 Antibody
Immunohistochemistry-Paraffin Cytokeratin 8 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, KO, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
FoxC2 Antibody
AF6989
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
(27 Publications)
Species: Mu
Applications: IHC
Choline Kinase
beta Recombinant Prot ...
NBP1-85632PEP
Choline Kinase beta Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Choline Kinase beta Protein (NBP1-85632PEP) (0)

There are no publications for Choline Kinase beta Protein (NBP1-85632PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Choline Kinase beta Protein (NBP1-85632PEP) (0)

There are no reviews for Choline Kinase beta Protein (NBP1-85632PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Choline Kinase beta Protein (NBP1-85632PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Choline Kinase beta Products

Research Areas for Choline Kinase beta Protein (NBP1-85632PEP)

Find related products by research area.

Blogs on Choline Kinase beta

There are no specific blogs for Choline Kinase beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody
NB300-223

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Choline Kinase beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CHKB