Novus Biologicals products are now on bio-techne.com

CD94 Recombinant Protein Antigen

Images

 
There are currently no images for CD94 Recombinant Protein Antigen (NBP2-48815PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

CD94 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD94.

Source: E. coli

Amino Acid Sequence: IEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLRD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48815.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD94 Recombinant Protein Antigen

  • CD94 antigen
  • CD94
  • CD94natural killer cells antigen CD94
  • Killer cell lectin-like receptor subfamily D member 1
  • killer cell lectin-like receptor subfamily D, member 1
  • KLRD1
  • KP43
  • NK cell receptor

Background

CD94 plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T cells. Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. KLRD1 has two alternatively spliced variants that differ in the presence or absence of exon 2 sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
MAB138
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-14845
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
202-IL
Species: Hu
Applications: BA
247-ILB
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
MAB24251
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD

Publications for CD94 Recombinant Protein Antigen (NBP2-48815PEP) (0)

There are no publications for CD94 Recombinant Protein Antigen (NBP2-48815PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD94 Recombinant Protein Antigen (NBP2-48815PEP) (0)

There are no reviews for CD94 Recombinant Protein Antigen (NBP2-48815PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD94 Recombinant Protein Antigen (NBP2-48815PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD94 Products

Research Areas for CD94 Recombinant Protein Antigen (NBP2-48815PEP)

Find related products by research area.

Blogs on CD94

There are no specific blogs for CD94, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD94 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRD1