Novus Biologicals products are now on bio-techne.com

CD37 Recombinant Protein Antigen

Name: CD37 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-33969PEP
Price: 279 USD

Images

There are currently no images for CD37 Protein (NBP2-33969PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD37 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD37. Source: E. coli Amino Acid Sequence: PCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CD37
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33969. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD37 Recombinant Protein Antigen

CD37 antigentetraspanin-26
CD37 molecule
CD37
cell differentiation antigen 37
GP52-40
leukocyte antigen CD37
MGC120234
Tetraspanin-26
TSPAN26
tspan-26
TSPAN26leukocyte surface antigen CD37

Background

CD37, also known as GP52-40, TSPAN26, MGC120234. Enterz Protein NP_001035120. It is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...

NBP2-79843

Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

CD53 Antibody
(MEM-53) - BSA Free

NB500-393

(1 Publication)

Species: Hu

Applications: CyTOF-ready, Flow, IHC, IHC-Fr, IP, WB

CD19 Antibody
(CB19) - BSA Free

NBP2-25196

(1 Review)

(12 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB

CD63 Antibody
(H5C6) - BSA Free

NBP2-42225

Flow (Intracellular) CD63 Antibody (H5C6) - BSA Free

Western Blot CD63 Antibody (H5C6) - BSA Free

(5 Reviews)

(56 Publications)

Species: Ca, Hu

Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB

CD9 Antibody
(MEM-61) - BSA Free

NB500-327

(1 Review)

(16 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB

CD20 Antibody
(AISB12) - BSA Free

NBP1-43435

Flow Cytometry CD20 Antibody (AISB12) - BSA Free

(3 Publications)

Species: Hu, Mu

Applications: Flow, WB

Cytokeratin 20
Antibody (SA35-03)

NBP2-67309

Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)

Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)

Species: Hu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

CD82/Kai-1
Antibody (C33) - BSA

NBP2-21792

Immunohistochemistry-Paraffin CD82/Kai-1 Antibody (C33) - BSA Free

Species: Hu

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB

Siglec-2/CD22
Antibody (OTI1F12)

NBP2-46125

(1 Review)

Species: Ca, Hu, Pm, Mu, Rt

Applications: ICC/IF, WB

CD81 Antibody
(1D6) - BSA Free

NB100-65805

Western Blot CD81 Antibody (1D6) - BSA Free

(1 Review)

(25 Publications)

Species: Gt, Hu, Mu, Pm, Sh

Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB

CD21 Antibody
(SC0681)

NBP2-67605

Immunohistochemistry-Paraffin CD21 Antibody (SC0681)

(1 Publication)

Species: Hu, Pm, Mu

Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB

Neprilysin/CD10
Antibody [Unconjugate

AF1126

Western Blot Neprilysin/CD10 Antibody [Unconjugated]

(22 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

CD23/Fc epsilon
RII Antibody [Unconju ...

AF123

(1 Review)

(2 Publications)

Species: Hu

Applications: Block, ICC, WB

CD38 Antibody
(1G7F4) - Azide Free

NBP2-25265

Western Blot CD38 Antibody (1G7F4) - Azide Free

Simple Western CD38 Antibody (1G7F4) - Azide Free

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

CD40/TNFRSF5
Antibody [Unconjugate

AF632

Western Blot CD40/TNFRSF5 Antibody [Unconjugated]

Simple Western CD40/TNFRSF5 Antibody [Unconjugated]

(7 Publications)

Species: Hu

Applications: AgAct, Simple Western, WB

ICAM-1/CD54
Antibody [Unconjugate

AF796

Western Blot ICAM-1/CD54 Antibody [Unconjugated]

(6 Reviews)

(85 Publications)

Species: Mu

Applications: AdBlk, IHC, WB

TSPAN8/TM4SF3
Antibody (458811) [Un ...

MAB4734

Flow Cytometry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]

Immunocytochemistry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]

(4 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, WB

CD37 Recombinant
Protein Antigen

NBP2-33969PEP

Species: Hu

Applications: AC

Publications for CD37 Protein (NBP2-33969PEP) (0)

There are no publications for CD37 Protein (NBP2-33969PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD37 Protein (NBP2-33969PEP) (0)

There are no reviews for CD37 Protein (NBP2-33969PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD37 Protein (NBP2-33969PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD37 Products

Research Areas for CD37 Protein (NBP2-33969PEP)

Find related products by research area.

Blogs on CD37.

Check out the latest blog posts on CD37.

CD81/TAPA1: I'm on Tapa the Cell
Target of the antiproliferative 1 (TAPA1), also known as CD81, is found in the plasma membrane in lymphocytes and plays an important role in the regulation of lymphoma cell growth. This transmembrane 4 superfamily (TM4SF) protein is primarily found on... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

ICAM-1/CD54 was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse ICAM-1/CD54 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF796) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in Leydig cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

ICAM-1/CD54 Antibody [Unconjugated]
AF796

Immunocytochemistry/Immunofluorescence: CD63 Antibody (H5C6) [NBP2-42225] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-CD63 [H5C6] conjugated to Alexa Fluor 488 [NBP2-42225AF488] at 10ug/mL for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.

CD63 Antibody (H5C6) - BSA Free
NBP2-42225

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our CD37 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CD37

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

CD37 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

CD37 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CD37 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CD37 Protein (NBP2-33969PEP) (0)

Reviews for CD37 Protein (NBP2-33969PEP) (0)

FAQs for CD37 Protein (NBP2-33969PEP) (0)

Additional CD37 Products

Research Areas for CD37 Protein (NBP2-33969PEP)

Blogs on CD37.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics