Calcineurin A Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PPP3CA |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Calcineurin A Antibody
Background
Calcineurin, a major soluble calmodulin binding protein in the brain, a Ca2+/calmodulin dependent serine/threonine protein phosphatase, with a relatively narrow substrate specificity. This metalloenzyme, also known as phosphatase 2B, is a heterodimer composed of a calmodulin binding, catalytic alpha subunit 61 kDa, calcineurin A) and calcium binding beta subunit (18 kDa, calcineurin B). The Ca2+ binding subunit, calcineurin B, is immunologically conserved from yeast to mammals. The presence of 2 different calcineurin B isoforms (beta 1 and beta 2) has been reported in rat testis. The catalytic subunit of calcineurin, calcineurin A, isolated from different tissues or different organisms, exhibits some immunological heterogeneity. Further, there are at least 2 isoforms of calcineurin A in bovine brain (alpha 1 and alpha 2, 61 and 59 kDa, respectively).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for Calcineurin A Antibody (NBP1-88218) (0)
There are no publications for Calcineurin A Antibody (NBP1-88218).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calcineurin A Antibody (NBP1-88218) (0)
There are no reviews for Calcineurin A Antibody (NBP1-88218).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calcineurin A Antibody (NBP1-88218) (0)