![Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding CACNB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CACNB2-Antibody-Immunohistochemistry-Paraffin-NBP1-86680-img0006.jpg "Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding CACNB2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CACNB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-86680 | Applications | Species |
|---|---|---|
| Cruz Garcia Y Interactome of the beta 2b subunit of L-type voltage-gated calcium channels in cardiomyocytes Thesis 2021-01-01 (ICC/IF, WB) | ICC/IF, WB | |
| Cruz-Garcia Y, Barkovits K, Kohlhaas M et al. Nanoenviroments of the beta-Subunit of L-Type Voltage-Gated Calcium Channels in Adult Cardiomyocytes Frontiers in cell and developmental biology 2022-01-03 [PMID: 35047492] (ICC/IF, WB, Rat) | ICC/IF, WB | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for CACNB2 Antibody (NBP1-86680)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CACNB2 |
![Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/CACNB2-Antibody-Immunohistochemistry-Paraffin-NBP1-86680-img0009.jpg "Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human cerebellum shows moderate to strong membranous positivity in Purkinje cells.](http://images.novusbio.com/fullsize/CACNB2-Antibody-Immunohistochemistry-Paraffin-NBP1-86680-img0007.jpg "Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human cerebellum shows moderate to strong membranous positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human cerebral cortex shows moderate to strong membranous positivity in neurons.](http://images.novusbio.com/fullsize/CACNB2-Antibody-Immunohistochemistry-Paraffin-NBP1-86680-img0008.jpg "Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human cerebral cortex shows moderate to strong membranous positivity in neurons.")
![Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human skeletal muscle shows very weak positivity in myocytes.](http://images.novusbio.com/fullsize/CACNB2-Antibody-Immunohistochemistry-Paraffin-NBP1-86680-img0010.jpg "Immunohistochemistry-Paraffin: CACNB2 Antibody [NBP1-86680] - Staining of human skeletal muscle shows very weak positivity in myocytes.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")