![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP1-93504-img0004.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
| Predicted Species | Mouse (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C9orf72 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID: 30003873). Use in ICC/IF reported in scientic literature (PMID: 25521377). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for C9orf72 Antibody (NBP1-93504)Find related products by research area.
|
|
Amyotrophic Lateral Sclerosis Infographic Amyotrophic lateral sclerosis is a neurological disease which impacts motor neurons that are involved in muscle movement throughout the body. The progressive degeneration of neurons causes weakened muscles and can lead to paralysis. There is no cure f... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP1-93504-img0001.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP1-93504-img0002.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP1-93504-img0003.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Western_Blot_15520.jpg)
![Immunohistochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunohistochemistry_7155.jpg)
![Immunocytochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunocytochemistry__Immunofluorescence_23051.jpg)
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Western_Blot_12719.jpg)
![Immunohistochemistry CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Immunohistochemistry_13107.jpg)
![Knockout Validated CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/mab7509_human-chmp2b-mab-clone-791521-knockout-validated-89202211244.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")