![Immunocytochemistry/Immunofluorescence: BRD3 Antibody [NBP2-14360] - Staining of human cell line MCF7 shows localization to nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/BRD3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14360-img0006.jpg "Immunocytochemistry/Immunofluorescence: BRD3 Antibody [NBP2-14360] - Staining of human cell line MCF7 shows localization to nuclear bodies. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSV |
| Predicted Species | Mouse (94%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BRD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BRD3 Antibody (NBP2-14360)Find related products by research area.
|
|
Understanding the relationship between NUT and BET proteins in NMC NUT has been found to fuse with bromodomain-containing proteins 3 and 4 (BRD3 and BRD4) in NUT midline carcinoma (NMC), a very rare, extremely aggressive, and genetically defined human cancer. NMC has recently been designated as a sub classificati... Read full blog post. |
|
NUT - A Protein Coding Gene The NUT gene is found on chromosome 15q14 and encodes for the NUT protein which is a key component of the RNA polymerase II Mediator complex. This multi-subunit assembly is required for all RNA pol II-dependent transcriptional activation, coordinating... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BRD3 |
![Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/BRD3-Antibody-Immunohistochemistry-Paraffin-NBP2-14360-img0011.jpg "Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize/BRD3-Antibody-Immunohistochemistry-NBP2-14360-img0007.jpg "Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/BRD3-Antibody-Immunohistochemistry-Paraffin-NBP2-14360-img0008.jpg "Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human testis shows moderate nuclear psotivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/BRD3-Antibody-Immunohistochemistry-Paraffin-NBP2-14360-img0010.jpg "Immunohistochemistry-Paraffin: BRD3 Antibody [NBP2-14360] - Staining of human testis shows moderate nuclear psotivity in cells in seminiferous ducts.")
![Immunohistochemistry DNER Antibody [Unconjugated]](https://images.novusbio.com/images2/DNER_AF2254_Immunohistochemistry_18506.jpg)
![Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]](https://images.novusbio.com/images/af2254_mouse-dner-affinity-purified-polyclonal-ab-41202412394943.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")