![Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in mouse lung.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-Western-Blot-H00081027-D01P-img0006.jpg "Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in mouse lung.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | TUBB1 (NP_110400.1, 1 a.a. - 451 a.a.) full-length human protein. MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH |
| Specificity | Reacts with tubulin, beta 1. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TUBB1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Simple Western beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/16250.jpg)
![Immunocytochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/beta-III_Tubulin_MAB1195_Immunocytochemistry_6556.jpg)
![Immunohistochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/betaIII_Tubulin_MAB1195_Immunohistochemistry_22757.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for beta I Tubulin Antibody (H00081027-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TUBB1 |
| Entrez |
|
| Uniprot |
|
![Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in A-431.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-Western-Blot-H00081027-D01P-img0004.jpg "Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in A-431.")
![Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in human liver.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-Western-Blot-H00081027-D01P-img0005.jpg "Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in human liver.")
![Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in transfected 293T cell line by TUBB1 polyclonal antibody.Lane 1: TUBB1 transfected lysate(50.30 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-Western-Blot-H00081027-D01P-img0007.jpg "Western Blot: beta I Tubulin Antibody [H00081027-D01P] - Analysis of TUBB1 expression in transfected 293T cell line by TUBB1 polyclonal antibody.Lane 1: TUBB1 transfected lysate(50.30 KDa).Lane 2: Non-transfected lysate.")
![Bioactivity Thrombopoietin/THPO [Unconjugated]](https://images.novusbio.com/images/protein/288-tpncf_recombinant-human-thrombopoietin-ns0-expressed-protein-cf-bioactivity-272020135047.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A IGFBP-1 [Biotin]](https://images.novusbio.com/images2/DATA_IGFBP1_DY871_ELISA_2250.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")